Amino Acids (AA)

<p>Please enquire for more information about H-Ala-Gly-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Lys-Tyr-Val-Nle-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cecropin A is an antimicrobial peptide, which is derived from the immune systems of insects, specifically moths. It displays potent antimicrobial properties through its ability to disrupt bacterial cell membranes, leading to cell lysis and death. This peptide primarily targets Gram-negative bacteria but is also effective against some Gram-positive strains. Cecropin A has garnered significant scientific interest due to its potential applications in developing new antimicrobial agents, particularly in the face of increasing antibiotic resistance. By integrating Cecropin A into therapeutic strategies, researchers aim to broaden the spectrum of antimicrobial options available for use in both clinical and agricultural settings, offering a promising avenue for future drug development.</p>

<p>Please enquire for more information about Boc-delta-azido-Nva-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Gly-Gly-OH is a tripeptide that has been synthesized and is used in microassays to measure the activity of methionine aminopeptidase. This enzyme hydrolyzes peptides with N-terminal amino acids such as methionine, which are derived from proteins. The activity of methionine aminopeptidase can be determined by measuring the release of H2O2, which is proportional to the concentration of peptides in the sample. The assay measures the change in absorbance at 340 nm on a spectrophotometer as a result of H2O2 production.</p>

<p>Levomilnacipran is a serotonin-norepinephrine reuptake inhibitor (SNRI) that is used for the treatment of major depressive disorder and fibromyalgia. It has been shown to have antidepressant effects in patients with major depressive disorder and fibromyalgia. Levomilnacipran inhibits the reuptake of serotonin and norepinephrine by blocking the transporter proteins in these neurotransmitter pathways, increasing their availability to interact with receptors in the brain. Levomilnacipran also has been found to inhibit aminotransferase activity, which may be responsible for its hepatotoxicity.</p>

<p>Macrophage inhibitory peptide H-Thr-Lys-Pro-OH is a human immunoglobulin that has been shown to have antimicrobial activity against a wide range of microbes. It is asymmetric and the side chain at position Thr is protonated, while the corresponding Lys side chain is not. Macrophage inhibitory peptide H-Thr-Lys-Pro-OH binds to the acidic corneal endothelial cells, which are important for maintaining a healthy eye surface. This peptide also activates human macrophages and basic fibroblast cells and inhibits HIV infection in monoclonal antibody mice.</p>

<p>Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt is a basic protein. It inhibits the neuronal death induced by dopamine and its derivatives, which is caused by overactivation of the mitochondrial membrane potential and release of cytochrome c from mitochondria to cytosol. This compound also inhibits the activation of toll-like receptor 4 (TLR4) and nuclear factor κB (NF-κB) signaling pathways in neuronal cells. Ac-Asp-Glu-Val-Asp-chloromethylketone trifluoroacetate salt has been shown to have antiinflammatory effects when applied topically on skin wounds. The molecule has been used as a model system for studying the molecular mechanism of epidermal growth factor (EGF) activation in hybridoma cell lines and primary cells.</p>

<p>Met-Lys-Bradykinin is a synthetic peptide with the amino acid sequence Met-Lys-Arg-Pro-Gly-Phe-Ser-Pro-Phe-Arg. It has been shown to have cytosolic Ca2+ release activity, protease activity, and vasodilator activities. The peptide also has binding affinity for human immunoglobulin G (IgG) and is able to form complexes with soybean trypsin.</p>

<p>Ac-Gln-NH2 is a multifunctional protein that has been covalently immobilized on the surface of a glass fiber. It can be used to immobilize enzymes and other proteins, as well as being able to function as an enzyme itself. Ac-Gln-NH2 has been shown to conjugate with various molecules, including antibodies, DNA, and proteins. The immobilizing process involves cross-linking the protein to the glass surface through a chemical method that uses reagents such as glutaraldehyde or epoxy resin. Immobilization of Ac-Gln-NH2 onto a glass surface allows for easier use in applications such as diagnostics and industrial processes.</p>

<p>H-Tyr-Trp-OH is a synthetic, constant ligand for nuclear receptors. It has been shown to be active in the cerebral cortex, with a brain concentration of about 1 µM at steady state. This compound has been shown to be an agonist of the transcription factor nuclear receptor peroxisome proliferator-activated receptor alpha (PPARα) and can be used as a potential therapeutic agent for Alzheimer's disease. H-Tyr-Trp-OH has also been shown to enhance phosphorylation of the microtubule protein tau in cultured cortical neurons, which may have implications for the treatment of Parkinson's disease.</p>

<p>Please enquire for more information about (Trp7,beta-Ala8)-Neurokinin A (4-10) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.</p>

<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Glu-Glu-Ala-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Ala-Gly-Sar-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>

<p>Cyclosporine is a cyclic peptide that is used as an immunosuppressive drug. It binds to the cytosolic protein phosphatase, preventing its activation. Cyclosporine also binds to other proteins in the cell, such as casein kinase II and cyclophilin, leading to changes in cellular function. It has been shown to inhibit the production of cytokines and other inflammatory mediators by inhibiting tyrosine kinase activity. Cyclosporine is metabolized into FK506, which has a similar structure but greater potency than cyclosporine. The mechanism of action for FK506 is not fully understood but it appears to be related to its ability to bind to tyrosine kinases and inhibit their activity.</p>

<p>H-Gly-Pro-Arg-Pro-NH2 acetate salt is a peptide with antiplatelet activity. It has been shown to inhibit the interaction between fibrinogen and platelets, which leads to the inhibition of thrombin formation and subsequent clotting. The amide bond in this peptide is susceptible to hydrolysis by enzymes such as phospholipase A2, which means that it can be broken down into smaller fragments that have different biological activities. H-Gly-Pro-Arg-Pro-NH2 acetate salt has been shown to inhibit the growth of babesia microti, a causative agent of babesiosis in cattle, through lysis of infected erythrocytes. This drug also inhibits the growth of hemagglutinating virus type 3 (HV3) and filovirus, two viruses that are not yet fully understood.</p>

<p>Please enquire for more information about Angiogenin (108-122) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Thr-Tyr-Ser-Lys-OH·2 TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glycine-arginine-aspartate (GAA) is a mimic of the endothelium-derived vasoactive peptide, nitric oxide (NO). It has been shown to attenuate the inflammatory response by decreasing leukocyte adhesion and migration. GAA is also a potent inhibitor of vascular permeability and can attenuate edema in animal models. Studies have shown that GAA prevents microvascular damage following brain infarction. The mechanism of action for GAA is not fully understood, but it may be due to its ability to inhibit fibronectin breakdown, which leads to cerebral edema. GAA's activity on the endothelium may be due to its ability to mimic NO or inhibit sulfate synthesis.</p>

<p>Please enquire for more information about N-((RS)-2-Hydroxy-propyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Val-D-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Lys3-GHRP-6 is a synthetic peptide that has been shown to stimulate cellular proliferation and inhibit apoptosis in cell culture. D-Lys3-GHRP-6 binds to the ghrelin receptor, which is found on cells in the stomach and pancreas, as well as in the brain. This binding stimulates the release of cytosolic calcium and enhances protein synthesis. D-Lys3-GHRP-6 also stimulates growth factor production and increases body fat mass in animals.</p>

<p>Please enquire for more information about Z-Arg-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Arg-Leu-OH acetate salt is a synthetic version of the natural amino acid Arginine. It has been shown to have anti-inflammatory effects and to inhibit the growth of cancer cells in cell culture. H-Arg-Leu-OH acetate salt also inhibits the production of messenger RNA that leads to the synthesis of inflammatory proteins and growth factors, as well as light emission, which may be due to its effect on response elements in cells.</p>

<p>Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>

<p>Please enquire for more information about Z-D-Ala-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteogenic growth peptide is a cyclic peptide that has been shown to activate the production of collagen and other proteins in fibroblasts. It has also been found to promote hematopoietic cell proliferation, as well as stimulate growth in cultured cells. Osteogenic growth peptide is an analog of TGF-β1, but it differs by having a tyrosine residue at the 10th position instead of an arginine residue. This difference in amino acid sequence alters the activity of this peptide and produces a new compound with different biological effects.</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Ala-Fmoc)-OH is a synthetic amino acid that is used in peptide synthesis. It is typically prepared by the condensation of Serine with diethyl Fmoc-amino acid and hydrochloric acid. This molecule has an efficient epimerization process, which allows for the synthesis of the other enantiomer, L-Ser(Ala-Fmoc)-OH. The synthetic method for Boc-Ser(Ala-Fmoc)-OH can be used to synthesize peptides from amino acids.</p>

<p>Cholecystokinin octapeptide (CCK-8) is a peptide hormone that is secreted from the pancreas. It is a conjugate of CCK and desulfated cholinesterase, which has been shown to have surfactant properties. The concentration-response curves for CCK-8 are biphasic, with an initial increase in contractility followed by a decrease. This response is caused by activation of both the B2 and B1 receptors in the paraventricular nucleus of the hypothalamus and subsequently release of pancreatic enzymes into the bloodstream. CCK-8 has also been shown to stimulate protein synthesis in gland cells such as those found in the pancreas.</p>

<p>Please enquire for more information about Fmoc-p-phenyl-D-phenylalanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Glutamine is a non-essential amino acid that is found in the cell in large amounts. It functions as a precursor of glutamate, an important neurotransmitter and intermediate in protein synthesis. Glutamine also has antioxidant properties, which may be due to its ability to donate hydrogen atoms or act as a reducing agent. Glutamine can be synthesized by glutaminase from glutamate and ammonia, but it can also be obtained from dietary sources. The uptake of glutamine is rapid at low concentrations, but becomes slower at higher concentrations. Glutamine is catabolized by the liver and kidney into glutamate and ammonia.<br>Glutamate dehydrogenase (GLDH) catalyzes the conversion of glutamate to α-ketoglutarate, producing NADH and H+.<br>The genetic mechanisms underlying the synthesis of glutamine are not well understood; however, one hypothesis states that glutamine could be synthesized from alpha-ketoglutarate via the reverse transamination reaction during periods when glucose</p>

<p>Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Polistes mastoparan is a peptide that was extracted from the venom of the European beewolf. It has been shown to have high affinity for tumor cells and can be used as a diagnostic agent. Polistes mastoparan has also been shown to have anti-inflammatory properties and inhibit the formation rate of glycopeptide antibiotics. This peptide can bind to calmodulin, which may be due to its β-amino acid sequence. Polistes mastoparan inhibits the growth of Stenotrophomonas maltophilia in vitro by binding to fatty acids on the cell membrane.</p>

<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>

<p>The compound Z-Tyr-Leu-NH2 is a synthetic molecule that inhibits the activity of metalloproteases. It binds to the active site of these enzymes, preventing them from cleaving their substrates. The enzyme's activity is inhibited by binding to uncharged amino acid residues in the active site, which prevents attack by the metal ion and therefore prevents cleavage of substrate proteins. Z-Tyr-Leu-NH2 has been shown to be effective against proteases that are involved in Alzheimer's disease and other neurodegenerative diseases. The optimal pH for this compound is 7.5, with a reaction time of 1 hour at 37 degrees Celsius. The transition temperature for this compound is -10 degrees Celsius, with a phase transition at -4 degrees Celsius.</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Thr(Gly-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Lys(Boc)-Thr(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-glu-OAll is a cyclic peptide that is synthesized using solid-phase synthesis. It has been shown to have minimal inhibitory concentration (MIC) values of 0.5 µg/mL against mouse tumor cells and human serum, as well as high affinity for integrin receptors. This peptide also binds to the human serum albumin and blood clotting factor Xa, which are proteins involved in cancer therapy.</p>

<p>Please enquire for more information about Fmoc-Homophe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>H-Met-Met-OH is a dietary supplement that has been shown to have a variety of health benefits in animals. It has been shown to increase the production of tnf-α and other fatty acids, which are known to play a role in cellular physiology. H-Met-Met-OH also has the ability to inhibit protein synthesis and this is thought to be due to its transport properties as well as its reaction products. H-Met-Met-OH can be taken orally or given through explants, either orally or by injection.</p>

<p>Omeprazole is a proton pump inhibitor that inhibits gastric acid secretion by binding to the H+/K+ ATPase enzyme in the secretory canaliculi of the parietal cells. Omeprazole has been shown to have a protective effect in animal models against infection with Salmonella enterica serovar Typhimurium, and also protects against ulcers caused by Helicobacter pylori infection. Omeprazole is used as an adjunct treatment for patients with non-infectious gastroesophageal reflux disease (GERD) or active duodenal ulcers. It has also been used for the prevention of stress-related mucosal damage in critically ill patients, although it is not approved for this use. Omeprazole can be administered orally or by injection. When administered orally, omeprazole may cause gastrointestinal side effects such as nausea, abdominal pain, and diarrhea. Omeprazole can interact with other drugs such</p>

<p>Lauroyl lysine (N6-Lauroyl-L-lysine) functions as skin and hair conditioning agents and as surfactants-cleansing agents in personal care products.</p>

<p>Please enquire for more information about Acetyl-Amylin (8-37) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Type A Allatostatin III including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-methoxybenzyl sulphone is a high quality, versatile building block that is used in the synthesis of complex compounds. It is a reagent that can be used for reactions such as the coupling of amines and carboxylic acids. 3-Amino-4-methoxybenzyl sulphone is also useful in the synthesis of pharmaceuticals and speciality chemicals. The compound has been shown to react with other substances, such as thiols and alcohols, to form new materials with interesting properties.</p>

<p>Please enquire for more information about H-Gly-Gly-Gly-Gly-Gly-NH2·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ala-Ala-Ala-OH is a calcium binding protein that is involved in the activation of zymogens. It is an acidic protein that can be found in the zymogen granules of bacteria such as Salmonella typhimurium. Ac-Ala-Ala-Ala-OH has been shown to bind to basic proteins and, when bound, enhances proteolytic activity. Acetylation of Ac-Ala-Ala-Ala-OH at its N terminus by chloromethyl ketone converts it into an acetyllysine derivative with increased stability, which may also result in decreased proteolytic activity.</p>

<p>Neuropeptide VF (124-131) (human) trifluoroacetate salt H-Val-Pro-Asn-Leu-Pro-Gln-Arg-Phe-NH2 trifluoroacetate salt is a peptide that is synthesized in the hypothalamus and is involved in the regulation of gonadotropin secretion. It has been shown to inhibit cell growth in vitro and to have an inhibitory effect on cancer cells. This peptide also binds to receptors α, adenohypophyseal, cellular, testicular, vasoactive intestinal peptide, messenger RNA, estradiol benzoate, cancer, and progesterone receptor.</p>

<p>Z-Arg-Arg-Pro-Phe-His-Sta-Ile-His-Lys(Boc)-OMe is an angiotensin II analogue that is used for the treatment of blood disorders. It inhibits angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II from angiotensin I. ACE inhibitors are also used to treat diseases such as glomerular dysfunction, congestive heart failure, high blood pressure, and cirrhosis. In addition, it has been shown to be effective in treating cardiovascular diseases such as hypertension and heart disease. ZARAPROHES is a synthetic substrate for nitrosation reactions and can be used to produce monoclonal antibodies against ACE.</p>

<p>Please enquire for more information about H-Met-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bradykinin (2-7) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Gly-Pro-Hyp-OH is a synthetic single-stranded amide with a stepwise hydrogen bond. The synthesis of this compound starts with the creation of an ester by reacting an acid and alcohol in the presence of catalysts. The ester is then reacted with a primary amine to form an amide, which can be hydrolyzed to release the desired product. This synthetic process has been used for the production of collagen and cyclic peptides. Fmoc-Gly-Pro-Hyp-OH has been modified to include modifications such as alkene and modifications such as strategies, synthons, and isosteres.</p>

<p>Pyr-Pro-Val-pNA is a synthetic peptide that is structurally homologous to the proteases serine and chymotrypsin. This peptide has been shown to have proteolytic activity on fibronectin, n-terminal of angiotensin, and epithelium. Pyr-Pro-Val-pNA also causes an inflammatory response in leukocytes and shigella.</p>

<p>N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is a synthetic chiral ligand that can be used as a building block in the synthesis of other compounds. It has been used to optimize the synthetic process, and it can be used in buffers, ammonium formate, metal chelate, and other additives to synthesize new compounds. N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is an optical isomer that can be used for supercritical fluid chromatography (SCFC) or liquid chromatography (LC). This compound has been shown to have a high affinity for ligands with a phenol group.</p>

<p>Please enquire for more information about (Tyr4,D-Phe12)-Bombesin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp(Boc)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Val-Lys-OH monoacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The compound Z-Pro-Leu-OH is a peptidomimetic that has been shown to be an effective inhibitor of the enzyme l-amino acid oxidase, which catalyzes the oxidation of l-amino acids. This inhibition may be due to the protonation of the substrate and/or solvents in the enzyme active site. The molecule is hydrophobic, making it suitable for use in simulations and theoretical studies. Furthermore, this compound is identifiable by its retention time on high performance liquid chromatography (HPLC) and can be rationalized by its amide group.</p>

<p>Please enquire for more information about N2-(2-Tricyclo[3.3.1.13,7]dec-1-ylacetyl)-D-arginyl-L-arginyl-L-prolyl-(4R)-4-hydroxy-L-prolylglycyl-3-(2-thienyl)-L-alanyl-L-seryl- D-phenylalanyl-3-(2-thienyl)-L-alanyl-L-arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-tBu-Gly-tBu-Gly-Asn(Me)2-Ala-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-Leu-OH is a protease inhibitor that belongs to the group of peptidyl-protease inhibitors. It inhibits the activity of a wide range of proteases and is specifically active against carboxypeptidases A and B. Z-Phe-Leu-OH has been shown to be specific for these enzymes, with no inhibitory activity against other proteases such as aminopeptidases, serine proteases, or metalloproteases. The amino acid composition of this protease inhibitor is different from other inhibitors that have been studied in detail. This agent was found to be more effective than phenylmethylsulfonyl fluoride (PMSF) at inhibiting carboxypeptidase A and B.<br>Z-Phe-Leu-OH has been shown to be an acidic compound with a pKa of 5.5; however, it does not react with chloromethyl ketone</p>

<p>Hippuryl-Phe-OH is a soybean trypsin inhibitor that has been shown to have irreversible inhibition of trypsin and other enzymes. It is active at low pH, with a ph optimum of 5.5. Hippuryl-Phe-OH binds irreversibly to the active site of enzymes, thereby preventing them from catalyzing reactions. This irreversible inhibition can be exploited for use in vitro assays as well as biological studies such as cell culture, animal models, and human serum studies.</p>

<p>H-Ala-His-Lys-OH acetate salt is a copper complex that has been shown to have antioxidant properties in vitro. It has been studied for use as an analog of the vitamin C, which is a cofactor for collagen synthesis and follicular keratinization. Copper complexes with H-Ala-His-Lys-OH acetate salt have been shown to inhibit the formation of reactive oxygen species (ROS) and to stimulate collagen production by human dermal fibroblasts in vitro. This compound also stimulates the growth of human skin cells in vitro, which may be due to its ability to induce fibroblast proliferation.</p>

<p>Please enquire for more information about H-Gly-Gly-Lys-Ala-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl-L-tyrosinate is a drug that has been shown to increase the activity of tyrosinase, an enzyme involved in the production of melanin. It also prevents the oxidation of tyrosine and phenylalanine, which are precursors to melanin. Methyl L-tyrosinate has been studied for its potential effects on hepatitis and Parkinson's disease. This drug binds to the hydroxyl group of tyrosinase and inhibits its activity. The inhibition of this enzyme leads to a decrease in melanin synthesis, which may be beneficial for those with vitiligo or other skin disorders where pigment loss is desired. This drug also prevents oxidative carbonylation and functional assays have shown that it has an affinity for potassium ion coordination chemistry.</p>

<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>

<p>Peptide 6A is a cyclic peptide that has been shown to have analgesic and anti-inflammatory effects. It is synthesized by conjugating the amino acid alanine to the N-terminal of arginine, which leads to a polymer conjugate. The cyclic peptide has been shown to inhibit pain responses in anesthetized animals as well as inhibit blood pressure in rats with hypertension. In addition, it showed significant vasodilatory effects and inhibited sodium citrate induced platelet aggregation. Treatment with peptide 6A also decreases fibrinogen levels in humans and showed radical scavenging activities in human serum.</p>

<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Cys-Tyr-OH)2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Phe-Phe-diazomethylketone is a cathepsin inhibitor that has been shown to inhibit the proteolytic activity of various enzymes, including serine proteases and thrombotic thrombocytopenic. This compound inhibits the growth of Leishmania parasites in cell culture and has been shown to have a high affinity for carboxy terminal and proximal tubules. Z-Phe-Phe-diazomethylketone has a neutral pH, with an optimum at 7.0, which may be due to its ability to bind to proteins or other components of cells without affecting their functions.</p>

<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Trp-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>