Amino Acids (AA)
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(4,016 products)
- Amino Acid and Amino Acid Related Compounds(3,490 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38383 products of "Amino Acids (AA)"
Boc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh)
Please enquire for more information about Boc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%H-Cys(farnesyl)-Val-Ile-Ser-OH
CAS:Please enquire for more information about H-Cys(farnesyl)-Val-Ile-Ser-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C32H56N4O6SPurity:Min. 95%Molecular weight:624.88 g/molN-Boc-(3S)-3-phenyl-3-aminopropionaldehyde
CAS:N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is a synthetic chiral ligand that can be used as a building block in the synthesis of other compounds. It has been used to optimize the synthetic process, and it can be used in buffers, ammonium formate, metal chelate, and other additives to synthesize new compounds. N-Boc-(3S)-3-phenyl-3-aminopropionaldehyde is an optical isomer that can be used for supercritical fluid chromatography (SCFC) or liquid chromatography (LC). This compound has been shown to have a high affinity for ligands with a phenol group.Formula:C14H19NO3Purity:Min. 95%Molecular weight:249.31 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:Intermediate in the synthesis of tedizolidFormula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/moltrans-4-Benzyloxy-3-methoxy-beta-nitrostyrene
CAS:Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is an oxime that can be used as a catalyst for the catalytic hydrogenation of nitroalkanes. It is also a precursor to pallimamine, which is used as a pharmaceutical agent and an experimental virucide. Trans-4-Benzyloxy-3-methoxy-beta-nitrostyrene is synthesized by coupling two indole carboxylic acid analogues in the presence of sodium hydroxide and potassium carbonate. The reaction yields trans-(4'-benzyloxy)-3'-methoxystyrene, which is then converted to the title compound with ammonium chloride and hydrochloric acid. This compound undergoes acidic hydrolysis to yield the title compound.
Formula:C16H15NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:285.29 g/molGRF (bovine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molAc-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt
CAS:Please enquire for more information about Ac-Ala-Ala-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C28H43N10O12PPurity:Min. 95%Molecular weight:742.67 g/molUrocortin (human) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molZ-Leu-Ala-OH
CAS:Z-Leu-Ala-OH is a casein extract that has been processed by ultrafiltration to remove impurities. It is used in the diagnosis of dermatophyte infections and other diseases. Z-Leu-Ala-OH has been shown to inhibit the growth of Trichophyton mentagrophytes, an organism that causes skin infections, as well as the growth of some bacteria and fungi. In addition, this extract can be used to diagnose collagen diseases such as pancreatic disease and fibrinogen disorders.Formula:C17H24N2O5Purity:Min. 95%Molecular weight:336.38 g/mol(Ala11·22·28)-VIP (human, mouse, rat) trifluoroacetate salt
CAS:(Ala11·22·28)-VIP is an endogenous peptide which is involved in the regulation of inflammation. It is a specific agonist for the vasoactive intestinal peptide receptor (VIP-R) and has been shown to exacerbate inflammatory responses such as those seen in tissues, intestines, and phagocytes. VIP also has effects on other cells types that are mediated by its ability to activate the VIP-R. These include increased vascular permeability and vasodilation, as well as increases in reactive oxygen species and cytokine production.
Formula:C139H231N43O39SPurity:Min. 95%Molecular weight:3,160.65 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/mol(d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond)
CAS:Please enquire for more information about (d(CH2)51,D-Phe2,Ile4,Ala-NH29)-Vasopressin b-Mercapto-b,b-cyclopentamethylene-propionyl-D-Phe-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disu lfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C53H78N13O10S2Purity:Min. 95%Molecular weight:1,121.4 g/molH-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH
CAS:Please enquire for more information about H-Pro-His-Pro-Phe-His-Leu-Phe-Val-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C60H77N13O11Purity:Min. 95%Molecular weight:1,156.33 g/molBoc-His(1-Mts)-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Boc-His(1-Mts)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H27N3O6S·C12H23NPurity:Min. 95%Molecular weight:618.83 g/molH-Pro-Leu-Gly-Gly-OH
CAS:Please enquire for more information about H-Pro-Leu-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C15H26N4O5Purity:Min. 95%Molecular weight:342.39 g/molH-Gly-Arg-Gly-Asp-Ser-OH TFA salt
CAS:H-Gly-Arg-Gly-Asp-Ser-OH TFA salt is a synthetic peptide that is designed to bind to the nuclear factor kappa B (NFκB) and inhibit its activation. NFκB is a transcription factor that regulates gene expression in response to various stimuli, including proinflammatory cytokines, oxidants, and electrophilic compounds. H-Gly-Arg-Gly-Asp-Ser-OH TFA salt has been shown to inhibit NFκB activation in a model system. This molecule also inhibits axonal growth and pluripotent cells differentiation, which may be due to its suppression of the signal peptide. The rate constant for this drug has been measured using polymer compositions and biocompatible polymers.Formula:C17H30N8O9(freebase)Purity:Min. 95%Molecular weight:490.47 g/molHippuryl-Gly-Gly-OH
CAS:Hippuryl-Gly-Gly-OH is a small molecule that inhibits the growth of bacteria. It is an inhibitor of epidermal growth factor (EGF) that binds to EGF and blocks its ability to interact with cells. Hippuryl-Gly-Gly-OH also has anti-inflammatory properties and has been shown to be effective against inflammatory bowel disease in vitro. This drug also has been shown to inhibit the enzyme activities associated with inflammatory bowel disease, such as COX2 and iNOS, in human serum, as well as inhibiting the production of proinflammatory cytokines from human peripheral blood mononuclear cells.
Formula:C13H15N3O5Purity:Min. 95%Molecular weight:293.28 g/molBoc-Val-PAM resin (200-400 mesh)
Please enquire for more information about Boc-Val-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%4-Fluoro-2-methoxyaniline
CAS:4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.Formula:C7H8FNOPurity:Min. 95%Color and Shape:Light Brown To Brown LiquidMolecular weight:141.14 g/mol
![N-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFF102200.webp&w=3840&q=75)
