
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30433 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PKItide
CAS:<p>PKItide demonstrates an inhibitory concentration 50 (IC50) of 0.2 μM against cAMP-dependent protein kinase (cAMP-PK) [1].</p>Formula:C85H149N31O24Purity:98%Color and Shape:SolidMolecular weight:1989.29β-MSH (1-22) human TFA (17908-57-5 free base)
β-Melanocyte Stimulating Hormone (MSH) is a 22-residue human peptide acting as a melanocortin-4 receptor agonist.Formula:C120H175F3N34O37SPurity:98%Color and Shape:SolidMolecular weight:2774.94PD-1/PD-L1-IN 3 TFA (1629654-95-0 free base)
PD-1/PD-L1-IN 3 TFA inhibits the binding of human PD-1 to PD-Ll with an IC50 of 9 nM.Formula:C91H127F3N24O20SPurity:98%Color and Shape:SolidMolecular weight:1966.19Vm24-toxin
CAS:<p>Vm24-toxin, a peptide toxin isolated from the Mexican scorpion Vaejovis mexicanus smithi, serves as an inhibitor of the Kv1.3 potassium channel [1].</p>Formula:C157H253N51O45S9Purity:98%Color and Shape:SolidMolecular weight:3863.59Tetrapeptide
CAS:<p>Tetrapeptide, an α-MSH analogue, stimulates melanin production and mitigates DNA damage by attenuating reactive oxidative species generation and augmenting DNA</p>Formula:C32H40N10O5Purity:98%Color and Shape:SolidMolecular weight:644.72PKCθ pseudosubstrate peptide inhibitor,myristoylated
<p>Myristoylated PKCθ pseudosubstrate peptide inhibitor is a synthetic peptide utilized to investigate the mechanism of action of protein kinase C theta (PKCθ) [1</p>Formula:C105H184N36O21SPurity:98%Color and Shape:SolidMolecular weight:2318.88TAT-SAMβA
<p>TAT-SAMβA, an RNAENFDRF (SAMβA) peptide conjugated to the TAT 47–57 protein-derived cell-penetrating peptide, acts as a selective antagonist of the Mfn1-βIIPKC</p>Formula:C118H195N51O31Purity:98%Color and Shape:SolidMolecular weight:2824.13mHuwentoxin-IV
<p>mHuwentoxin-IV, a naturally modified form of Huwentoxin-IV, selectively inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels in dorsal root</p>Formula:C174H276N52O50S6Purity:98%Color and Shape:SolidMolecular weight:4088.76PKC 20-28,myristoylated
<p>Myristoylated protein kinase C inhibitor 20-28 (PKC 20-28,myristoylated) is a cell-permeable inhibitor of protein kinase C, utilized in cancer research [1].</p>Formula:C60H106N18O11Purity:98%Color and Shape:SolidMolecular weight:1255.6Fibrinopeptide B, human TFA (36204-23-6 free base)
<p>FibrinopeptideB,human is a 14-amino acid polypeptide released from the amino terminus of the fibrinogen segment.</p>Formula:C68H94F3N19O27Purity:98%Color and Shape:SolidMolecular weight:1666.58Xenopsin
CAS:<p>Xenopsin (Xenopsin(2TFA))(2TFA) is a neurotensin-like octapeptide previously isolated from amphibian skin.</p>Formula:C47H73N13O10Purity:98%Color and Shape:SolidMolecular weight:980.16Z-Leu-Leu-Tyr-COCHO
CAS:<p>Z-Leu-Leu-Tyr-COCHO is a potent inhibitor of chymotrypsin-like activity, exhibiting a Ki value of 3.0 nM [1].</p>Formula:C30H39N3O7Purity:98%Color and Shape:SolidMolecular weight:553.65Rac1 Inhibitor F56, control peptide acetate
<p>Rac1 Inhibitor F56, control peptide acetate is a control peptide version of Rac1 Inhibitor; comprises residues 45-60 of Rac1 with Trp56 replaced by Phe.</p>Formula:C74H120N18O25SPurity:98%Color and Shape:SolidMolecular weight:1692.94REDV TFA
<p>REDV TFA, the minimal active sequence of the CS5 site in the alternatively spliced type III connecting segment (IIICS) of fibronectin, mediates adhesion to the</p>Formula:C20H35N7O9·xC2HF3O2Purity:98%Color and Shape:SolidMolecular weight:517.53 (free acid)HIV-1 TAT (48-60) Acetate
<p>Lilotomab (HH1) is a murine anti-CD37 antibody that can be used to synthesize anti-CD37 antibody-radionuclide couplings.</p>Formula:C72H135N35O18Purity:99.93%Color and Shape:SoildMolecular weight:1779.07Cyclo(RGDfC) TFA
<p>Zelminemab (AMG-301) is a humanized monoclonal antibody targeting ADCYAP1R1 for use in neurological disorders.</p>Formula:C26H35F3N8O9SPurity:98.59%Color and Shape:SolidMolecular weight:692.67Agouti-related Protein (AGRP) (25-82), human
<p>AgRP is a brain-produced neuropeptide, made in hypothalamic neurons, stoking appetite; leptin blocks and ghrelin activates it.</p>Formula:C279H468N80O90S1Purity:98%Color and Shape:SolidMolecular weight:6415.39ShK toxin
CAS:<p>ShK toxin, isolated from the Caribbean sea anemone (Stichodactyla helianthus), is an inhibitor of the voltage-dependent potassium channel (Kv1.3 channel).</p>Formula:C169H274N54O48S7Purity:98%Color and Shape:SolidMolecular weight:4054.8Platelet Membrane Glycoprotein IIB Peptide (296-306)
GPllb: 125 Kd heavy chain, 23 Kd light chain linked by disulfide, single transmembrane domain near C-terminus anchors to platelet.Formula:C47H75N17O20Purity:98%Color and Shape:SolidMolecular weight:1198.2Mast Cell Degranulating Peptide HR-2
CAS:<p>Peptide from giant hornet Vespa orientalis that has biological effects similar to mast cell degranulating peptide from bee venom.</p>Formula:C77H135N17O14Purity:98%Color and Shape:SolidMolecular weight:1523CysHHC10 acetate
<p>CysHHC10 acetate is antibacterial; MIC: E. coli 10.1mM, P. aeruginosa 20.2mM, S. aureus 2.5mM, S. epidermidis 1.3mM.</p>Formula:C79H111N23O12SPurity:98.33%Color and Shape:SolidMolecular weight:1606.94Leucopyrokinin
CAS:<p>Leucopyrokinin is a myotropic neuropeptide.</p>Formula:C42H66N12O12Purity:98%Color and Shape:SolidMolecular weight:931.05EGF Receptor Substrate 2 Phospho-Tyr5
<p>EGF Receptor Substrate 2 (Phospho-Tyr5) is a biologically active peptide derived from an autophosphorylation site (Tyr992) of EGFR.</p>Formula:C54H82N13O24Purity:98%Color and Shape:SolidMolecular weight:1328.28Boc-Gly-Gly-Phe-Gly-OH TFA(187794-49-6,free)
<p>Boc-Gly-Gly-Phe-Gly-OH TFA is a self-assembly of N-protected and C-protected tetrapeptides and is a protease cleaved connector for antibody-drug binding (ADC).</p>Formula:C22H29F3N4O9Purity:98%Color and Shape:SolidMolecular weight:550.48Dentonin acetate
<p>Dentonin acetate enhances osteogenesis and facilitates immature adherent cell survival.</p>Formula:C109H164N30O44Purity:96.91%Color and Shape:SolidMolecular weight:2598.64MCA-SEVNLDAEFR-K(Dnp)-RR, amide
CAS:<p>MCA-SEVNLDAEFR-K(Dnp)-RR, amide is a FRET-based substrate.</p>Formula:C86H125N27O29Purity:98%Color and Shape:SolidMolecular weight:2001.08SP-346 nonapeptide
CAS:<p>SP-346 nonapeptide is a pipecolic acid substituted nonapeptide.</p>Formula:C48H77N13O14Purity:98%Color and Shape:SolidMolecular weight:1060.221YAP-TEAD-IN-1 acetate
<p>YAP-TEAD-IN-1 acetate is an effective and competitive inhibitor of YAP–TEAD interaction with an IC50 of 25 nM.</p>Formula:C95H148ClN23O23S2Purity:98.11% - 99.57%Color and Shape:SoildMolecular weight:2079.92Egg Laying Hormone, aplysia
CAS:<p>ELH, a neuropeptide from Aplysia's bag cells, triggers egg laying, has 36 amino acids, Mr 4385, pI 9.7, and induces Na+ current in neurons.</p>Formula:C190H329N59O57SPurity:98%Color and Shape:SolidMolecular weight:4384.2SNAP-25 187-203
<p>Amino acids 187-203 from SNAP-25's C-terminal helix can restore exocytosis in BoNT/E-affected cells at high doses.</p>Formula:C71H125N27O26Purity:98%Color and Shape:SolidMolecular weight:1772.92SNAP8
CAS:<p>SNAP8 (Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-Nh2) is a mimic of the N-terminal end of SNAP-25 which competes with SNAP-25 for a position in the SNARE complex,</p>Formula:C41H70N16O16SPurity:98%Color and Shape:SolidMolecular weight:1075.16Biotin-myelin basic protein (94-102)
CAS:<p>Biotin-myelin basic protein (94-102) is a peptide fragment crucial for myelin adhesion within the nervous system, facilitating myelination.</p>Formula:C49H84N20O13SColor and Shape:SolidMolecular weight:1193.38β-Amyloid (1-15)
CAS:<p>β-Amyloid (1-15) (Amyloid β-Protein (1-15)) is a fragment of β-amyloid protein used in the study of Alzheimer's disease.</p>Formula:C78H107N25O27Purity:99.88%Color and Shape:SolidMolecular weight:1826.84Endostatin (84-114)-NH2 (JKC367)
<p>Endostatin, a non-toxic and resistance-free compound, strongly inhibits tumor growth, angiogenesis, and metastasis with over 150-fold reduction.</p>Formula:C161H236N48O43Purity:98%Color and Shape:SolidMolecular weight:3531.9Nifalatide
CAS:<p>Nifalatide is a analog of enkephalin.</p>Formula:C30H39N7O9SPurity:98%Color and Shape:SolidMolecular weight:673.74Lagatide
CAS:<p>Lagatide is a synthetic heptapeptide that has antisecretory activity.</p>Formula:C33H58N10O9Purity:98%Color and Shape:SolidMolecular weight:738.88LCMV gp33-41 acetate
<p>LCMV gp33-41 acetate is a sequence of lymphocytic choriomeningitis virus which restricted by major histocompatibility complex class I H-2Db and presented to</p>Formula:C50H77N11O15SPurity:95.93%Color and Shape:SolidMolecular weight:1104.28[Pro3]-GIP (Rat)
<p>Rat GIP receptor partial agonist with Kd of 13 nM, boosts cAMP in COS-7 cells, competitively antagonizes GIP.</p>Formula:C226H343N61O64SPurity:98%Color and Shape:SolidMolecular weight:4970.63C-Peptide, dog
CAS:<p>Dog C-Peptide, part of proinsulin, is secreted by pancreatic beta cells with insulin; vital for insulin biosynthesis, once deemed inert.</p>Formula:C137H225N37O49Purity:98%Color and Shape:SolidMolecular weight:3174.47HPV16 E7 (86-93) (TFA)(160212-93-1,free)
<p>HPV16 E7 (86-93) TFA is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide.</p>Formula:C39H67F3N8O12SPurity:98%Color and Shape:SolidMolecular weight:929.06Ornithine glutamate dipeptide
CAS:<p>Ornithine glutamate dipeptide is a amino acid.</p>Formula:C10H19N3O5Purity:98%Color and Shape:SolidMolecular weight:261.27Quinupristin-Dalfopristin Complex (mesylate)
<p>Quinupristin-dalfopristin is a synergistic streptogramin antibiotic combo, with types A (Dalfopristin) & B (Quinupristin).</p>Formula:C34H51N4O9SCH3SO3·C53H68N9O10SCH3SO3Purity:98%Color and Shape:SolidMolecular weight:1905.3PKCε Inhibitor Peptide acetate
<p>PKCε Inhibitor Peptide acetate is a selective PKCε inhibitor containing the site for its specific receptor for activated C kinase (RACK).</p>Formula:C39H69N9O15Purity:98.93%Color and Shape:SolidMolecular weight:904.02eukaryotic translation initiation factor 3
<p>Eukaryotic initiation factors (eIF) are proteins involved in the initiation phase of eukaryotic translation.</p>Formula:C47H84N14O14SPurity:98%Color and Shape:SolidMolecular weight:1101.32Ac-IEVDIDV (TFA)
<p>Ac-IEVDIDV TFA is a short peptide sequence.</p>Formula:C39H62F3N7O17Purity:98%Color and Shape:SolidMolecular weight:957.94Eptifibatide
CAS:Eptifibatide is an antiplatelet, a cyclic heptapeptide made of 6 amino acids and a mercaptopropionyl.Formula:C35H49N11O9S2Purity:98%Color and Shape:White PowderMolecular weight:831.96BNP-45 (rat) (TFA) (123337-89-3 free base)
<p>BNP-45 (rat) TFA is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.</p>Formula:C215H350N71O67F3S3Purity:98%Color and Shape:SolidMolecular weight:5154.69amyloid A protein fragment [Homo sapiens]
<p>Amyloid A proteins are apolipoproteins in HDL linked to inflammation, with acute-phase marker SAA rising rapidly post-stimulus, potentially outpacing CRP.</p>Formula:C36H56N8O11Purity:98%Color and Shape:SolidMolecular weight:776.88R 892
CAS:<p>Bradykinin B1 antagonist, ID50: 2.8 nM (B1), >600 nM (B2), no agonist action, aminopeptidase/ACE resistant, causes hypertension in vivo.</p>Formula:C58H83N13O12Purity:98%Color and Shape:SolidMolecular weight:1154.37Deapio platycodin D
<p>Deapio platycodin D is extracted from Platycodon grandiforus.</p>Formula:C52H84O24Purity:98%Color and Shape:SolidMolecular weight:1092.32D-JBD19 TFA (954134-42-0 free base)
<p>D-JBD19 TFA is a non-permeable peptide with neuroprotective effects.</p>Formula:C101H165F3N32O30Purity:98%Color and Shape:SolidMolecular weight:2364.58Gp100 (25-33), human TFA (212370-40-6 free base)
Gp100 (25-33), human TFA is a 9-AA melanoma antigen fragment, h-2db restricted, T cell recognized.Formula:C54H83F3N16O16Purity:98%Color and Shape:SolidMolecular weight:1269.33RA X Peptide
CAS:<p>RA X Peptide is used as an antitumor cyclic hexapeptide.</p>Formula:C43H52N6O11Purity:98%Color and Shape:SolidMolecular weight:828.92SIYRY
CAS:<p>SIYRY is a Kb-restricted epitope peptide.</p>Formula:C50H71N11O13Purity:98%Color and Shape:SolidMolecular weight:1034.16Jagged-1 (188-204)
CAS:<p>Jagged-1 (188-204)is a fragment of the JAG-1 protein. JAG-1 is Notch ligand, a peptide that is the most conspicuously expressed ligand in skin.</p>Formula:C93H127N25O26S3Purity:98%Color and Shape:SolidMolecular weight:2107.4GroES mobile loop
<p>GroES mobile loop is a flexible region of unbound GroES that interacts with GroEL via the residues located at the tip of the loop.</p>Formula:C51H90N14O20Purity:98%Color and Shape:SolidMolecular weight:1219.4P17 Peptide
CAS:<p>P17 Peptide, a human TGF-β1 inhibitory peptide, effectively blocks the activity of woodchuck TGF-β1.</p>Formula:C95H139N27O21Color and Shape:SolidMolecular weight:1995.29Kisspeptin 10 (dog)
<p>Endogenous canine KISS1 receptor ligand; boosts LH, FSH, estradiol secretion.</p>Formula:C65H87N17O14Purity:98%Color and Shape:SolidMolecular weight:1330.51Sarasinoside A1
CAS:<p>Sarasinoside A1 is a triterpenoid saponin that reverses mesenchymal tumor transformation.</p>Formula:C62H100N2O26Purity:98%Color and Shape:SolidMolecular weight:1289.47Neuropeptide S (human)
CAS:Endogenous neuropeptide S receptor agonist, EC50 = 9.4 nM; boosts wakefulness and activity, lowers anxiety in mice.Formula:C93H155N31O28SPurity:98%Color and Shape:SolidMolecular weight:2187.5Ac-VDID (TFA)
Ac-VDID TFA is a short peptide sequence with Ac at the end.Formula:C23H35F3N4O12Purity:98%Color and Shape:SolidMolecular weight:616.54Mini Gastrin I, human TFA (54405-27-5 free base)
<p>Mini Gastrin I, human (TFA) is short for human Gastrin. It is a mother peptide composed of 5-17 amino acids.</p>Formula:C76H100F3N15O28SPurity:98%Color and Shape:SolidMolecular weight:1760.75AGA-(C8R) HNG17, Humanin derivative
CAS:<p>This peptide is a potent humanin (HN) derivative. It completely suppresses neuronal cell death by Alzheimer's disease-relevant insults.</p>Formula:C78H134N20O24Purity:98%Color and Shape:SolidMolecular weight:1736.02PNU-145156E (FCE26644)
CAS:<p>PNU-145156E, an angiogenesis blocker with anti-tumor effects in mice, inhibits growth factors in animal studies.</p>Formula:C45H36N10Na4O17S4Purity:96.15%Color and Shape:SolidMolecular weight:1209.04CGRP II, rat (TFA) (99889-63-1 free base)
<p>Calcitonin Gene Related Peptide (CGRP) II, rat (TFA) is a neuropeptide with 37 amino acid.</p>Formula:C165H268F3N51O52S2Purity:98%Color and Shape:SolidMolecular weight:3919.33Large T antigen - rhesus polyomavirus 560-568
Large T antigen peptide (rhesus polyomavirus 560-568): Ser-Glu-Phe-Leu-Leu-Glu-Lys-Arg-Ile; vital for viral replication & assembly.Formula:C52H87N13O15Purity:98%Color and Shape:SolidMolecular weight:1134.33Protein Kinase C (19-31) (TFA)(121545-65-1,free)
<p>Protein Kinase C (19-31) TFA is a serine-modified PKCa-derived inhibitor for testing PKC activity.</p>Formula:C69H119F3N26O18Purity:98%Color and Shape:SolidMolecular weight:1657.84BMAP-28
CAS:<p>BMAP-28, an antibiotic peptide, induces cell death by triggering the mitochondrial permeability transition pore and serves as a research tool in the study of</p>Formula:C145H250N44O29Purity:98%Color and Shape:SolidMolecular weight:3073.81ProTx III
<p>Potent Nav1.7 inhibitor (IC50=2.5nM); blocks Nav1.1/1.2/1.3/1.6; no Cav/nAChR impact at 5μM; analgesic; counters scorpion toxin OD1.</p>Formula:C162H246N52O43S6Purity:98%Color and Shape:SolidMolecular weight:3802.41M-2420
CAS:<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Formula:C70H91N15O27Purity:98%Color and Shape:SolidMolecular weight:1574.56Xenin
CAS:<p>Xenin is a 25 amino acid peptide that has been identified in human gastric mucosa in the search for a counterpart to the amphibian octapeptide xenopsin.</p>Formula:C139H224N38O32SPurity:98%Color and Shape:SolidMolecular weight:2971.57Smcy HY Peptide (738-746)
CAS:<p>Smcy HY Peptide (738-746) is an H2-Db-restricted peptide, derived from the amino acid sequence 738 to 746 of the Smcy protein.</p>Formula:C48H82N18O14SPurity:98%Color and Shape:SolidMolecular weight:1167.34VIP(Guinea pig)
CAS:<p>Neuropeptide with many biological actions</p>Formula:C147H239N43O42S2Purity:98%Color and Shape:SolidMolecular weight:3344.86Leu-Val
CAS:<p>Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.</p>Formula:C11H22N2O3Purity:97.72%Color and Shape:SolidMolecular weight:230.3Foxy-5 acetate
<p>Foxy-5 acetate: Wnt 5A agonist, inhibits cancer cell migration/invasion, boosts calcium signaling, doesn't activate β-catenin.</p>Formula:C28H46N6O14S2Purity:98%Color and Shape:SolidMolecular weight:754.83Trempamotide
CAS:<p>Trempamotide is a bioactive chemical.</p>Formula:C58H80N10O18Purity:98%Color and Shape:SolidMolecular weight:1205.31pp60 c-src (521-533) (phosphorylated)
CAS:<p>Peptide binds pp60c-src/v-src SH2, inhibiting kinase, phosphorylated at Tyr527.</p>Formula:C62H95N16O28PPurity:98%Color and Shape:Lyophilized PowderMolecular weight:1543.5LAH4 acetate
<p>LAH4 acetate is the α-helical structure of the designed amphoteric peptide antibiotic, which is capable of complexing DNA, associating with the cell surface</p>Formula:C134H232N38O29Purity:98.41%Color and Shape:SoildMolecular weight:2839.51vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
<p>Vitamin D-binding protein transports vitamin D, has immune roles, is highly polymorphic, and responds to dietary strontium.</p>Formula:C54H95N17O17Purity:98%Color and Shape:SolidMolecular weight:1254.44WT-1 A1
CAS:<p>WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.</p>Formula:C55H74N10O13SPurity:98%Color and Shape:SolidMolecular weight:1115.3PYX 1
CAS:<p>PYX 1 is an effective orexigenic peptide.</p>Formula:C70H105Cl2N19O16Purity:98%Color and Shape:SolidMolecular weight:1539.61Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Purity:98%Color and Shape:SolidMolecular weight:3692.15Palmitoyl dipeptide-7
CAS:<p>Palmitoyl dipeptide-7 is a peptide.</p>Formula:C26H51N3O5Purity:98%Color and Shape:SolidMolecular weight:485.7Conotoxin GII
CAS:<p>Conotoxin GII is a highly toxic peptide.</p>Formula:C57H81N19O16S4Purity:98%Color and Shape:SolidMolecular weight:1416.63Thelenotoside B
CAS:Thelenotoside B is a triterpene tetraglycoside.Formula:C55H88O23Purity:98%Color and Shape:SolidMolecular weight:1117.286Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:<p>Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.</p>Formula:C32H45N9O10SPurity:98%Color and Shape:SolidMolecular weight:747.82cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Formula:C126H202N42O40S2Purity:98%Color and Shape:SolidMolecular weight:3009.36CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formula:C162H262N50O52S2Purity:98%Color and Shape:SolidMolecular weight:3806.3immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
<p>Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.</p>Formula:C54H83N13O13Purity:98%Color and Shape:SolidMolecular weight:1122.32Fibrinogen-Binding Peptide
CAS:<p>Fibrinogen-binding peptide mimics vitronectin site and activates platelets; thrombin turns it to fibrin.</p>Formula:C25H39N7O8Purity:98%Color and Shape:SolidMolecular weight:565.62Competence-Stimulating Peptide-12261
CAS:<p>Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.</p>Formula:C100H149N31O23Purity:98%Color and Shape:SolidMolecular weight:2153.45Preprosomatostatin (25-34)
CAS:<p>Preprosomatostatin (25-34) is a peptide.</p>Formula:C52H83N17O15Purity:98%Color and Shape:SolidMolecular weight:1186.32type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
<p>Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).</p>Formula:C47H77N13O15Purity:98%Color and Shape:SolidMolecular weight:1064.19PR 39 (porcine) acetate
<p>PR 39 (porcine) acetate is a noncompetitive, reversible and allosteric proteasome inhibitor.</p>Purity:98%Color and Shape:LiquidMolecular weight:N/ATAK-683 TFA (872719-49-8 free base)
<p>TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.</p>Formula:C66H84F3N17O15Purity:98%Color and Shape:SolidMolecular weight:1412.47OVA sequence (323-336)
CAS:<p>This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencity</p>Formula:C63H100N20O22Purity:98%Color and Shape:SolidMolecular weight:1489.59RETF-4NA
CAS:chymase substrate peptideFormula:C32H43N9O10Purity:98%Color and Shape:SolidMolecular weight:713.74CLIP (86-100) (TFA) (648881-58-7 free base)
<p>CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.</p>Formula:C74H129F3N20O21S3Purity:98%Color and Shape:SolidMolecular weight:1788.13Sperm-activating peptide 1
CAS:<p>Sperm-activating peptide 1 is a bioactive chemical.</p>Formula:C44H71N11O12S2Purity:98%Color and Shape:SolidMolecular weight:1010.23Pep1-TGL
<p>Peptide containing the 'TGL' motif that corresponds to the C-terminus of GluR1 subunit</p>Formula:C41H71N11O15SPurity:98%Color and Shape:SolidMolecular weight:990.14

