Peptides
Subcategories of "Peptides"
Found 29641 products of "Peptides"
Biotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formula:C126H190N34O35Molecular weight:2,773.19 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SMolecular weight:3,260.75 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Formula:C25H37N5O7Molecular weight:519.6 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formula:C164H278N58O45S4Molecular weight:3,910.64 g/molDok-5 (263-275)
Catalogue peptide; min. 95% purity
Formula:C75H114N24O19Molecular weight:1,655.89 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formula:C112H167N27O34S5Molecular weight:2,596 g/molAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formula:C79H116N22O17Molecular weight:1,645.9 g/mol[Ala8]-Humanin, [Ala8]-HN, Shna
Catalogue peptide; min. 95% purity
Formula:C119H204N34O32SMolecular weight:2,655.23 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Formula:C217H322N58O60SMolecular weight:4,767.47 g/molPeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C190H288N54O57Molecular weight:4,240.64 g/molInfluenza A NP (366-374)
Catalogue peptide; min. 95% purity
Formula:C36H59N11O17S2Molecular weight:982.06 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Molecular weight:1,260.47 g/molBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Molecular weight:1,326.53 g/molBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C16H25N3O6Purity:Min. 95%Color and Shape:SolidMolecular weight:355.39 g/molRef: 3D-FB111250
Discontinued productγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SMolecular weight:3,481.96 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formula:C176H251N43O53SMolecular weight:3,849.30 g/molα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formula:C45H59N11O8Molecular weight:882.04 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PMolecular weight:1,574.69 g/molPrepro TRH (53-74)
Catalogue peptide; min. 95% purity
Formula:C118H182N32O32Molecular weight:2,560.96 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111733
Discontinued productGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formula:C28H36N6O6Molecular weight:552.64 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SMolecular weight:3,103.54 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formula:C8H4BrClK2NO4PPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:402.65 g/molRef: 3D-EB110885
Discontinued productAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Molecular weight:3,935.55 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Molecular weight:1,383.68 g/molZ-Ile-Val-OH
CAS:Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C19H28N2O5Purity:Min. 95%Molecular weight:364.44 g/molRef: 3D-FI111494
Discontinued productCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formula:C89H152N22O15Molecular weight:1,770.34 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SMolecular weight:1,522.81 g/molAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formula:C45H82N14O13SMolecular weight:1,059.31 g/molBoc-D-Glu-OEt·DCHA
CAS:Controlled ProductPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurity:Min. 95%Molecular weight:456.62 g/molRef: 3D-FB111281
Discontinued productCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purity:Min. 95%Molecular weight:2,088.86 g/molRef: 3D-BC184180
Discontinued productAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Molecular weight:966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SMolecular weight:1,079.27 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purity:Min. 95%Molecular weight:1,287.65 g/molRef: 3D-BC183236
Discontinued product
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![[Ala8]-Humanin, [Ala8]-HN, Shna](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00593.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
