Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 29635 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
β-Casomorphin (1-5), amide, bovine
CAS:β-Casomorphin (1-5), amide, bovine is a peptide of bovine β-Casomorphin.Formula:C31H42N6O6SPurity:98%Color and Shape:SolidMolecular weight:626.77Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purity:98%Color and Shape:SolidMolecular weight:3692.15Ceratotoxin A acetate
Ceratotoxin A acetate is isolated from the accessory gland secretion fluid, with anti-bacterial effects.Formula:C137H247N35O34Purity:98.49%Color and Shape:SolidMolecular weight:2928.641,3-Dimethyl-3,4,5,6-tetrahydro-2(1H)-pyrimidinone
CAS:Formula:C6H12N2OPurity:≥ 98.0%Color and Shape:Colourless to light yellow liquidMolecular weight:128.18Super-TDU 1-31
Super-TDU (1-31) is a peptide of Super-TDU, which is an inhibitor of YAP-TEADs, shows potent anti-tumor activity.Formula:C141H218N40O48Purity:98%Color and Shape:SolidMolecular weight:3241.48Super Fluor 555, SE
Super Fluor 555, SE, a bright, photostable dye for proteins and antibodies, enables sensitive cellular detection without self-quenching.Purity:98%Color and Shape:SolidMolecular weight:N/ADusquetide aceate
Dusquetide acetate: innate immune modulator with anti-inflammatory and antibacterial properties.
Formula:C27H51N9O7Purity:97.33%Color and Shape:SolidMolecular weight:613.75N-Hydroxysuccinimide
CAS:Formula:C4H5NO3Purity:(Titration) ≥ 98.0%Color and Shape:White to almost white crystalline powderMolecular weight:115.09A-71915 TFA (132956-87-7 free base)
A-71915 (TFA) selectively blocks ANP receptor, causing cell death and reduced insulin in RINm5F β-cells.Formula:C71H117F3N26O17S2Purity:98%Color and Shape:SolidMolecular weight:1727.98Peptide C105Y
CAS:C105Y, a synthetic peptide mimicking alpha1-antitrypsin residues 359-374, boosts DNA nanoparticle gene expression.Formula:C97H148N20O23SPurity:98%Color and Shape:SolidMolecular weight:1994.4Somatostatin 1-28
CAS:Somatostatin receptor agonist, derived from the post-translational cleavage of prosomatostatin.Formula:C137H207N41O39S3Purity:98%Color and Shape:SolidMolecular weight:3149β-Amyloid 15-21
β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease. This fragment is involved in beta sheet formation.Formula:C43H65N9O9Purity:98%Color and Shape:SolidMolecular weight:852.03H-Ala-Ala-Tyr-OH (TFA) (67131-52-6 free base)
H-Ala-Ala-Tyr-OH TFA can be synthesized mutant peptides.Formula:C17H22F3N3O7Purity:98%Color and Shape:SolidMolecular weight:437.37Fibronectin Adhesion-promoting Peptide TFA
Fibronectin peptide aids MSC aggregation by heparin-binding, promoting spheroid assembly.Formula:C49H75F3N16O12Purity:98%Color and Shape:SolidMolecular weight:1137.22N-Oleoyl Glutamine
CAS:N-Oleoyl Glutamine (Oleoyl-L-glutamine) antagonizes TRPV1 of the transient receptor potential (TRP) calcium channel.
Formula:C23H42N2O4Purity:99.61%Color and Shape:SolidMolecular weight:410.59Biotin-Crosstide TFA
Biotin-crosstide is a derivative of the peptide Akt substrate crosstide, featuring biotinylation.Formula:C58H91N19O19S·XCF3COOHColor and Shape:SolidMolecular weight:1390.53α-Gliadin (43-49)
CAS:alpha-Gliadin (43-49) is a Gliadian sequence peptide. It could induce leukocyte migration inhibition but be blocked by naloxone.Formula:C43H57N9O11Purity:98%Color and Shape:SolidMolecular weight:875.97ACTH (1-13)
CAS:ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.Formula:C75H106N20O19SPurity:98%Color and Shape:SolidMolecular weight:1623.83Lanatoside D
CAS:Lanatoside D is a cardiac glycoside.Formula:C49H76O21Purity:98%Color and Shape:SolidMolecular weight:1001.126-CR110 Single isomer
CAS:6-CR110 Single isomer is a rhodamine-class green fluorescent dye with ex/em=499/525 nm for DNA or protein labelling and cell staining.Formula:C21H15N2O5ClPurity:98%Color and Shape:SolidMolecular weight:410.81
