Peptides

<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Catalogue peptide; min. 95% purity

<p>For-Nle-Leu-Phe-Nle-Tyr-Lys-OH is an amino acid sequence that is a proteolytic fragment of the erythrocyte membrane protein band 3. It has been shown to be able to inhibit the activity of cytosolic calcium and actin filament polymerization, as well as inhibiting apoptosis in human polymorphonuclear leukocytes (PMNL). This compound has been found to be effective in preventing uptake of bacteria by neutrophils, which may be due to its ability to alter the pH gradient across the membrane and increase intracellular calcium levels. For-Nle-Leu-Phe-Nle-Tyr-Lys-OH also inhibits diacylglycerol synthesis, which may contribute to its antiinflammatory effects.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Rec FGF basic (human) is a human recombinant growth factor that has been shown to be effective in the treatment of life-threatening conditions. Rec FGF basic (human) stimulates the proliferation of various tissue cells, including butyric acid, which are found in abdominal and intestinal tissues. Rec FGF basic (human) also promotes the synthesis of collagen, a protein that is important for healthy skin and vascular walls. Rec FGF basic (human) has been shown to inhibit platelet-derived growth factor and estradiol production, which may be beneficial in the treatment of breast cancer. Rec FGF basic (human) has also been shown to stimulate tissue plasminogen activator production, which prevents blood clot formation and helps dissolve blood clots that have already formed.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Nle-Leu-Phe-OH is a potent colony-stimulating factor that binds to the receptor on the surface of cells and stimulates the production of white blood cells. Nle-Leu-Phe-OH has been shown to induce actin filament formation, which is necessary for cell movement. It also induces cytosolic calcium release and enhances protein synthesis. Nle-Leu-Phe-OH also binds to phosphatase and inhibits its activity, which may be due to a conformational change in the enzyme. This process is necessary for the synthesis of DNA and other proteins from amino acids. Nle-Leu-Phe-OH also causes an increase in the uptake of Ca2+ ions by cells.</p>

<p>Hippuryl-His-Leu-OH is a peptide that inhibits the activity of angiotensin converting enzyme (ACE) at a concentration of 50 μM. It has been shown to inhibit cyclase and other enzymes in vitro. The binding of this compound to ACE prevents the conversion of angiotensin I to angiotensin II, which is a potent vasoconstrictor. Hippuryl-His-Leu-OH also has inhibitory properties against atrial natriuretic peptide (ANP), and can be used as an antihypertensive agent. This drug has been shown to have growth factor β1 activities, and can be used for the treatment of cardiac diseases such as myocardial infarction. Structural analysis shows that this drug binds to the active site of ACE, inhibiting its activity by blocking access to substrate or by altering substrate specificity.</p>

Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.

Lysine is an essential amino acid, which means that it cannot be synthesized by the body and must be obtained from food. It is a crucial component of many proteins, including enzymes and hormones. Lysine is also involved in calcium absorption, maintaining nitrogen balance, and the production of carnitine. Lysine hydrobromide is a salt form of lysine that can be used to inhibit protein synthesis in bacteria. This inhibition can take place at either the transcriptional or translational level, but not both simultaneously. The inhibition of protein synthesis prevents the cell from growing and reproducing. Lysine hydrobromide has been shown to have a regulatory effect on enzyme activities in corynebacterium glutamicum (a type of bacteria). It also acts as a substrate for uptake by corynebacterium glutamicum cells due to its high lysine content.

<p>Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Flagellin 22 trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-L-cysteic acid disodium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>