Peptides

<p>Peptide H-FALNAANAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NQEKVSPLTLLKLGN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The ME™ Kit is used for specific isolation of extracellular vesicles (exosomes, microvesicles) in as little as 45 minutes using a standard bench top centrifuge. This product is optimized for urine or media samples and contains the 1mg Vn96 peptide (enough for 20x samples), 500µl ME buffer, a negative control (100µg Vn96 scrambled peptide) and 50µl purified exosomes from HEK293 cells as positive control.Extracellular vesicle isolation, is becoming essential in diagnostics and therapeutics. These small membrane-enclosed particles play important roles in many biological processes, including communication, immune response, tissue regeneration, and tumor progression. They are also being studied for their use as biomarkers for various diseases and as potential therapeutics against cancer, neurodegenerative disorders, and inflammatory conditions. It is becoming known that blood profiling alongside exosome analysis provides scientists with suitable resources to monitor disease progression.<br>To combat the challenges associated with exosome isolation Cymit Quimica have developed two ME™ Kits, available for purchase online based on optimization for how different sample types behave: urine or media samples (ME-020) and plasma samples (ME-020P). Our technique produces results comparable to ultracentrifugation, but at much greater efficiency as 1/30th the sample size is required, fulfilling the needs of the diagnostic and pharma industries.<br>The underlaying mechanisms of how the kit works – an affinity for canonical HSPs – may allow for this to be applied fairly broadly, since HSPs are roundly conserved from bacteria to higher order mammals.For more information on the effectiveness and flexibility of this extracellular isolation technology read our publication (Gosh, 2014).</p>

<p>Peptide Ac-CKSLLWKKVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-NIQLINTNGSWHINST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-MEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GALALAQAVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

Peptide Fluor-HEHRKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LNNISIIGPLDMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GQSIQPFISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Ser-Leu-Ile-Gly-Lys-Val-OH is a potent inhibitor of the enzyme soybean trypsin. It is a member of the class of chemical inhibitors that are active against enzymes that regulate cell signaling and inflammatory responses. H-Ser-Leu-Ile-Gly-Lys-Val-OH inhibits toll receptor signaling, which triggers an inflammatory response in cells. This compound has been shown to be effective in animal models for bowel disease and asthma. H Ser Leu Ile Gly Lys Val OH also has low potency, which may be due to its ability to form covalent bonds with other molecules, such as DNA polymerase.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DPLPDPLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-KKVVFKVKFK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DSTGSFVLPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-FLRPGDDSSHDLMLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

This product is of Hepcidin Baboon, Cynomolgus, Macaque, and Gorilla origin contains the disulfide bonds: Cys7- Cys23, Cys10- Cys13, Cys11- Cys19, and Cys14- Cys22. Hepcidin is a hormone that is produced by the liver in response to iron overload and regulates iron uptake in the gastrointestinal tract. Hepcidin binds to ferroportin, the protein that transports iron across the enterocyte cell membrane, and mediates internalization of ferroportin. Interestingly Hepcidin also displays antimicrobial activity as it reduces the amount the iron available to pathogens invading the body.

<p>Peptide H-ALKPGVIQILGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>C1q is a glycoprotein that belongs to the collectin family, having a molecular weight of about 410-462 kDa.  C1q’s main physiological role is in the clearance of immune complexes and apoptotic bodies from the organism.Supplier as a 10 mM HEPES solution containing NaCl.</p>

Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SLYSFPEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-GNQWVGYDDQESVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>H-His-Ala-OH is a peptide hormone that is derived from the amino acid histidine. It has been shown to be a potent inhibitor of tumor growth in human breast cancer tissue and human serum. H-His-Ala-OH inhibits the release of peptide hormones, such as insulin and glucagon. This compound also has anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins. H-His-Ala-OH interacts with collagen via a number of mechanisms, including inhibition of proteolytic enzymes and binding with collagenase. H-His-Ala-OH also binds to casein, which is found in milk. The interaction between casein and H-His-Ala-OH leads to an increase in systolic blood pressure in rats and mice.</p>

<p>Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-YTFELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GFPSVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>

Peptide H-GPGGVWAAEAISDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Ac-Leu-Val-Ser-Arg-MCA is a peptide that has been identified as a potential MALT1 substrate. It is a small, cationic peptide with a molecular weight of 1,261. Ac-Leu-Val-Ser-Arg-MCA binds to the active site of MALT1 and inhibits its activity by binding to the zinc atom in the enzyme's active site. Ac-Leu-Val-Ser-Arg-MCA also prevents bacterial adhesion to epithelial cells and decreases inflammatory cytokines such as IL1β and TNFα.</p>

<p>Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Pyr-Gly-Arg-AMC is a peptide that can be used as a research tool to study the interactions between proteins in the cell. Pyr-Gly-Arg-AMC binds to the receptor site of ion channels and inhibits their function. The high purity of this product means that it is suitable for use in research.</p>

<p>Peptide H-VV^GADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-EMPSEEGYQDYEPEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Z-Leu-Arg-AMC is an ion channel activator that belongs to the group of peptides. It is a high purity reagent for use in research, which can be used as a pharmacological tool and as a research tool for studying protein interactions. Z-Leu-Arg-AMC is also an inhibitor of peptidases, such as chymotrypsin, trypsin, and elastase.<br>Z-Leu-Arg-AMC has been shown to activate voltage gated potassium channels by binding to the extracellular domains of these channels. This activation leads to the opening of potassium channels and an increase in potassium efflux from cells.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-TPAQFDADELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-SIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DLQNFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VEITYTPSDGTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CKESPVIAKYMPTEAVRVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Aoa-ATCYCRTGRCATRESLSGVCEISGRLYRLCCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EQFLDGDGWTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

D-Cysteine hydrochloride monohydrate (Cys-OH·HCl·H2O) is a derivative of the amino acid D-Cysteine. It has potential application in research and chemical synthesis.

Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DRVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HQGLPQEVLNENLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Ac-Nle-Pro-Nle-Asp-MCA is a peptide that is used as an enzyme substrate to study the ubiquitin proteasome system. This peptide is hydrolyzed by proteasomes and degraded into small peptides. Ac-Nle-Pro-Nle-Asp-MCA has been shown to be a potent inhibitor of the ubiquitin proteasome system in vitro.</p>

Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-VSAQQVQGVHAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VTSIQDWV^QK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AALEDTLAETEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SHALQLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Pr-EIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

<p>Peptide H-TITSSYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Octreotate is a radiopharmaceutical that is synthesized by reacting DOTA-Tyr3 with octreotide acetate. Octreotate, also known as dotatate, is used in nuclear medicine to treat neuroendocrine tumours. This drug has a high yield and can be reliably prepared using cassettes and computerised equipment to create germanium-68 labelled octreotate. The radionuclide emits positrons and gamma rays, which are used for imaging neuroendocrine tumours in the brain or other organs. Octreotate is a synthetic analogue of the natural hormone octreotide, which binds to receptors on the cell surface and prevents the release of hormones from cells. This may be due to its ability to inhibit protein synthesis by inhibiting rRNA synthesis.</p>

<p>Peptide Ac-SLRRYP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

(S)-N-(2-(2-Cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)quinoline-4-carboxamide is a small molecule that inhibits protein interactions. It has a molecular weight of 312.5 and the chemical formula C10H14FN3O2. This drug can be used as a research tool in pharmacology, cell biology, and biochemistry to study protein interactions, ion channels, and receptor activation.

<p>Peptide H-VSFLSALEEYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DATNVGDEGGFAPNILENK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VITAFNDGLNHLDSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Ac-Ile-Glu-Thr-Asp-AMC is a reactive, nonsteroidal anti-inflammatory drug that inhibits the activity of survivin, which is an important protein for the survival of prostate cancer cells. Ac-Ile-Glu-Thr-Asp-AMC also inhibits mitochondrial membrane potential in prostate cancer cells and normal peripheral blood mononuclear cells, leading to apoptosis. The biochemical properties of Ac-Ile-Glu-Thr-Asp-AMC are similar to those of other NSAIDs. This drug has been shown to inhibit protein synthesis in experimental models and hydrochloric acid causes mitochondrial membrane depolarization, which triggers apoptosis.</p>

<p>Peptide H-FNLAGNHEQEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Ac-Gly-Pro-Leu-Asp-MCA [Ac-GPLD-MCA] is a proteasome substrate that is used in the study of the Ubiquitin Proteasome System (UPS). Acetylglycine proline leucine aspartic acid methylamide, or Ac-GPLD-MCA, is a synthetic peptide derived from the sequence of ubiquitin. It is an inhibitor of the proteasome and was shown to be more potent than acetylphenylalanine proline leucine aspartic acid methylamide (APLPDAM), another proteasome inhibitor. Acetylglycine proline leucine aspartic acid methylamide has been shown to inhibit peptides and biochemicals such as amino acids and proteins from being degraded by the proteasomes.

<p>Peptide H-LGADMEDVCGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDLTIANLGTSEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-REEEDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FSP^DDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 6Azido-TFYGGRPKRNNFLRGIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EGDCNFVAPQGISSIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Neuromedin S (Human) is a peptide that belongs to the class of ligands. It is an activator of G-protein coupled receptors, ion channels and other membrane proteins. Neuromedin S (Human) has been shown to inhibit the binding of serotonin to its receptor, which may be due to its ability to compete with serotonin for binding sites. Neuromedin S (Human) has also been shown to activate potassium channels on the cell membrane.</p>

<p>Peptide H-DQIPELENNEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LGSSEVEQVQLVVDGVK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Lys(Glucitol, Boc)-OH is a synthetic peptide that acts as an inhibitor of the ion channel TRPC3. It binds to the ligand-binding site of TRPC3, preventing activation by its natural agonist, lysophosphatidic acid (LPA). Fmoc-Lys(Glucitol, Boc)-OH can also be used as a research tool in pharmacology and cell biology. It has been shown to inhibit the growth of cancer cells. This product is available at a purity of &gt; 98%.</p>

<p>Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a cyclic peptide that has been shown to have antiangiogenic properties. It may be used as a linker for the conjugation of drugs to compounds with different target specificities. Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a negative control peptide that has the RGD sequence, which is the most common motif in peptides that are used for cell targeting. This peptide was tested against human ovarian carcinoma and inhibited endothelial cell proliferation and tumor vasculature formation. Cyclo(Arg-Ala-Asp-D-Phe-Lys) also inhibited angiogenesis in vitro and in vivo, suggesting that it may be useful for the treatment of cancer and other diseases involving abnormal blood vessel growth.</p>

<p>Peptide H-VL^DFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-IFYNQQNHYDGSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-SPSYSPTSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDTGETGVTGVEGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CMLVELHTQSQDRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide 5Azido-AAAYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LL^EAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-YLAEVAAGDDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ILGGHLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-QVLQVTPFAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-TLNAWVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is a peptide macrocycle that has been shown to have potent anti-cancer activity. It binds to the receptor for epidermal growth factor (EGF), which is overexpressed in many cancers, and inhibits its function. Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is also able to inhibit the production of nitric oxide by inhibiting the synthesis of arginase. This peptide has also been shown to induce apoptosis in cancer cells by altering the mitochondrial membrane potential and activating caspases 3 and 9.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-QVPSRPNRAP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VEIFYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CAEPQKSPW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YDPSLKPLSVSYDQATSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RAAAAAAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-SQNYPIVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-NQAEEELIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QRPIF^IITEYMANGCLLNYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-V^V^GGLVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LSSPAVITDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Anti-Flt1 Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-DWSSWVYRDPQT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Ac-Val-Phe-Arg-Ser-Leu-Lys-MCA is a peptide substrate for Site 1 Protease (S1P). Ac-Val-Phe-Arg-Ser-Leu-Lys is the sequence of amino acids that is cleaved by S1P. Acetylation of the side chain of Lys residue in the peptide substrate increases the hydrophilicity and decreases the reactivity with S1P. This product can be used to study and characterize enzymes that are involved in proteolysis, such as Site 1 Protease.</p>

Peptide H-FGDIVPLGVTHMTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GVQIPLPEGINFVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LGGDLGTYVINK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Ac-QKRGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Casein Kinase II Assay Kit is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide LCBiot-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-TTDGYLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-APWIEQEGPEYWDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VQII^NK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Pro-OBzl • Cl is a monoclonal antibody that binds to the active site of the ns3 protease, which is an enzyme that is involved in the processing of many proteins. Pro-OBzl • Cl has been shown to inhibit cancer cell growth and to reduce microbial infection by decreasing their ability to produce virulence factors. Pro-OBzl • Cl also has been shown to be effective against viruses such as hepatitis B virus. This drug binds to the receptor on the surface of cells and inhibits viral entry into cells.</p>

<p>Peptide H-VVVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GAEDSLADQAANK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Pepstatin A is a natural product that inhibits the activity of proteases, particularly chymotrypsin and trypsin. It binds to the active site of these enzymes, blocking access to their substrate. Pepstatin A has been shown to have synergistic effects with other drugs in vitro, such as dapsone and clindamycin. Pepstatin A has inhibitory properties against infectious diseases, including HIV-1 and HIV-2, influenza virus type A (H1N1), herpes simplex virus type 1 (HSV-1), human papilloma virus type 18 (HPV-18), hepatitis C virus (HCV) types 1a and 1b, as well as dengue fever virus. Pepstatin A is also effective in inhibiting polymerase chain reaction amplification of mitochondrial DNA from patients with mitochondrial disorders. The biological sample for this research was obtained from calf thymus tissue. The natural compound pepstatin A has</p>

<p>H-Trp-Pro-OH is an amide that can be used as a model system in the preparation of collagen. It has been shown to inhibit the linker between collagen molecules, which may lead to the formation of proline-rich peptides. H-Trp-Pro-OH has also been found to have anticancer properties, and inhibits cancer cell growth by inhibiting protein synthesis and promoting apoptosis. H-Trp-Pro-OH was found to inhibit cancer cells through a mechanism that is not yet fully understood, but it may involve both competitive inhibition of amino acids and activation of apoptosis through reactive oxygen species.</p>

<p>Peptide H-YNGIITETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TA^VNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GITWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>2-Acetamido-3,4,6-tri-O-acetyl-2-deoxy-β-D-galactopyranosyl-(1→4)-threonine is a fine chemical that is used as a building block in the synthesis of other compounds. The CAS No. 133575-43-6 identifies this compound as an intermediate in the synthesis of complex compounds and scaffolds. 2AATG2T has been shown to be a versatile building block that can be used in reactions such as amide bond formation, esterification, and peptide coupling reactions. This compound has been shown to be useful for research purposes and as a reagent for biological studies.</p>

Peptide H-MPRHSRAKRAPRPSAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.