
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30318 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-Asp-Glu-Val-Asp-H (aldehyde)
CAS:<p>Ac-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that belongs to the group of ligands. It has been used as an inhibitor of ion channels and as an antibody for cell biology research. Ac-Asp-Glu-Val-Asp-H (aldehyde) is a potent activator of the class IB metabotropic glutamate receptors and has been shown to inhibit the activity of the Na+/K+ ATPase pump in rat brain synaptosomes. This peptide also binds to beta 2 adrenergic receptors with high affinity, but does not activate them.</p>Formula:C20H30N4O11Purity:Min. 95%Molecular weight:502.47 g/molH-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2
CAS:<p>H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 is a potent activator of the human growth hormone receptor, which leads to increased levels of insulin growth factor 1 (IGF1). H-His-D-Trp-Ala-Trp-D-Phe-Lys NH2 causes an increase in locomotor activity and somatotrophs. This peptide has been shown to be effective in treating metabolic disorders such as obesity and diabetes mellitus type 2. It also has antiviral properties that may be useful for the treatment of infectious diseases, such as HIV.</p>Formula:C46H56N12O6Purity:Min. 95%Molecular weight:873.04 g/molObestatin (Human)
CAS:Obestatin is a 23 amino acid gastrointestinal peptide, encoded for by the ghrelin gene and is known to reduce food intake through supressing appetite. This peptide has been found to influence the pancreas, cardiovascular system and adipose tissues as well as the gastrointestinal system. One study showed that when high-fat diet fed rats were given chronic administration of obestatin it prevented the development of non-alcoholic fatty liver disease. Consequently Obestatin has the potential to be used in preventing obesity-related diseases.Formula:C116H176N32O33Purity:Min. 95%Molecular weight:2,546.89 g/molBz-L-Arg-pNA·HCl
CAS:Bz-L-Arg-pNA • HCl is a protease inhibitor. It is a competitive inhibitor of bovine pancreatic trypsin, chymotrypsin, and elastase. Bz-L-Arg-pNA • HCl has also been shown to inhibit the growth of cancer cells in culture and to induce apoptosis. Bz-L-Arg-pNA • HCl binds to the active site of cathepsin and thiol proteases, inhibiting their activity by blocking peptide bond hydrolysis. This drug has been shown to inhibit proteolytic activation of proinflammatory cytokines such as IL1β, IL6, IL8, and TNFα.Formula:C19H22N6O4•HCIPurity:Min. 95%Molecular weight:434.88 g/molH-Ser-Leu-Ile-Gly-Arg-Leu-NH2
CAS:<p>H-Ser-Leu-Ile-Gly-Arg-Leu-NH2 is a cyclase inhibitor that binds to the neurokinin 1 receptor, leading to an inhibition of the release of inflammatory substances in the bowel. HSLIGRL can also inhibit epidermal growth factor (EGF), which suppresses inflammation and cell proliferation. HSLIGRL also inhibits inflammatory bowel disease by decreasing the production of prostaglandins, which are chemical messengers involved in pain and inflammation. HSLIGRL has been shown to be effective against low potency benzalkonium chloride, which is often used as a preservative in pharmaceuticals. This compound has been shown to reduce inflammation by inhibiting proinflammatory cytokines such as TNFα and IL1β.</p>Formula:C29H56N10O7Purity:Min. 95%Molecular weight:656.83 g/molFmoc-Ser(tBu)-OH
CAS:<p>Fmoc-Ser(tBu)-OH is a synthetic peptide that is used in the synthesis of peptides and proteins. It is synthesized by using a stepwise procedure, which involves the use of morpholine as an organic base to deprotonate the carboxylic acid group and then reacting it with trifluoroacetic acid (TFA) to form the corresponding chloroformate ester. The amide bond is formed by reaction with ammonia or an amine. Finally, it can be reacted with hydrochloric acid to form the corresponding hydrochloride salt, which is insoluble in water. Impurities such as thionyl chloride and chloroformate can be removed by washing with methylene chloride or chloroform, respectively. Fmoc-Ser(tBu)-OH has been shown to be selective for the formation of hydrophobic bonds between amino acids and is not reactive toward other side chains on the protein.</p>Formula:C22H25NO5Purity:Min. 98.0 Area-%Molecular weight:383.45 g/molBoc-Asp(OBzl)-OH
CAS:<p>Boc-Asp(OBzl)-OH is a cyclic peptide analog with an amino acid sequence homologous to the natural substrate of soybean trypsin. It has been shown to inhibit thrombin by intramolecular hydrogen bonding. Boc-Asp(OBzl)-OH has also been used as a prodrug for the synthesis of other analogs, such as Asp(OBzl)-Bz-NH2, which inhibits human immunodeficiency virus type 1 (HIV-1) protease. This inhibitor has been found to be effective in vitro and in vivo against HIV-1 strains that are resistant to other protease inhibitors, such as saquinavir, indinavir, and ritonavir.</p>Formula:C16H21NO6Purity:Min. 95%Molecular weight:323.34 g/molPepstatin A (Purity Higher than 90% by HPLC)
CAS:<p>Pepstatin A is a natural product that inhibits the activity of proteases, particularly chymotrypsin and trypsin. It binds to the active site of these enzymes, blocking access to their substrate. Pepstatin A has been shown to have synergistic effects with other drugs in vitro, such as dapsone and clindamycin. Pepstatin A has inhibitory properties against infectious diseases, including HIV-1 and HIV-2, influenza virus type A (H1N1), herpes simplex virus type 1 (HSV-1), human papilloma virus type 18 (HPV-18), hepatitis C virus (HCV) types 1a and 1b, as well as dengue fever virus. Pepstatin A is also effective in inhibiting polymerase chain reaction amplification of mitochondrial DNA from patients with mitochondrial disorders. The biological sample for this research was obtained from calf thymus tissue. The natural compound pepstatin A has</p>Formula:C34H63N5O9Purity:Higher Than 90% By Hplc)Molecular weight:685.89 g/molPro-OBzl • Cl
CAS:<p>Pro-OBzl • Cl is a monoclonal antibody that binds to the active site of the ns3 protease, which is an enzyme that is involved in the processing of many proteins. Pro-OBzl • Cl has been shown to inhibit cancer cell growth and to reduce microbial infection by decreasing their ability to produce virulence factors. Pro-OBzl • Cl also has been shown to be effective against viruses such as hepatitis B virus. This drug binds to the receptor on the surface of cells and inhibits viral entry into cells.</p>Formula:C12H15NO2•HCIPurity:Min. 95%Molecular weight:241.7 g/molCyclo(Arg-Ala-Asp-D-Phe-Lys)
CAS:<p>Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a cyclic peptide that has been shown to have antiangiogenic properties. It may be used as a linker for the conjugation of drugs to compounds with different target specificities. Cyclo(Arg-Ala-Asp-D-Phe-Lys) is a negative control peptide that has the RGD sequence, which is the most common motif in peptides that are used for cell targeting. This peptide was tested against human ovarian carcinoma and inhibited endothelial cell proliferation and tumor vasculature formation. Cyclo(Arg-Ala-Asp-D-Phe-Lys) also inhibited angiogenesis in vitro and in vivo, suggesting that it may be useful for the treatment of cancer and other diseases involving abnormal blood vessel growth.</p>Formula:C28H43N9O7Purity:Min. 95%Molecular weight:617.71 g/molFmoc-Lys(Glucitol, Boc)-OH
CAS:<p>Fmoc-Lys(Glucitol, Boc)-OH is a synthetic peptide that acts as an inhibitor of the ion channel TRPC3. It binds to the ligand-binding site of TRPC3, preventing activation by its natural agonist, lysophosphatidic acid (LPA). Fmoc-Lys(Glucitol, Boc)-OH can also be used as a research tool in pharmacology and cell biology. It has been shown to inhibit the growth of cancer cells. This product is available at a purity of > 98%.</p>Formula:C32H44N2O11Purity:Min. 95%Molecular weight:632.71 g/molTAPI-2 acetate salt
CAS:<p>TAPI-2 is an inhibitor of ADAM-17 (also called TACE) and matrix metalloproteinases (MMPs). It acts as a broad-spectrum inhibitor of these enzymes. TAPI-2 prevents the shedding of tumor necrosis factor-alpha (TNF-α) from cell membranes and can sensitize cancer stem cells to the effects of chemotherapy such as 5-fluorouracil (5-FU) in vitro. It also blocks the phorbol ester-induced shedding of other cell surface proteins like TGF-α and β-amyloid precursor protein.</p>Formula:C19H37N5O5Purity:Min. 95%Molecular weight:415.53 g/molH-Ser-Leu-Ile-Gly-Lys-Val-OH
CAS:<p>H-Ser-Leu-Ile-Gly-Lys-Val-OH is a potent inhibitor of the enzyme soybean trypsin. It is a member of the class of chemical inhibitors that are active against enzymes that regulate cell signaling and inflammatory responses. H-Ser-Leu-Ile-Gly-Lys-Val-OH inhibits toll receptor signaling, which triggers an inflammatory response in cells. This compound has been shown to be effective in animal models for bowel disease and asthma. H Ser Leu Ile Gly Lys Val OH also has low potency, which may be due to its ability to form covalent bonds with other molecules, such as DNA polymerase.</p>Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molCGRP (Human)
CAS:<p>Human CGRP with a disulfide bond between Cys2-Cys7 and available as a 0.1mg vial. CGRP (calcitonin gene-related peptide) is a 37-amino acid neuropeptide that is found in humans and is widely distributed in the nervous system, particularly in sensory neurons, and is involved in the regulation of vascular tone, blood flow, pain perception, and inflammation. It is a potent vasodilator and has been implicated in the pathophysiology of several vascular disorders, including migraine headaches, cluster headaches, and hypertension.<br>In addition to its vascular effects, human CGRP also has neuroprotective properties and has been investigated as a potential therapeutic agent for various neurological disorders, such as Alzheimer's disease and Parkinson's disease.<br>Human CGRP has been extensively studied as a research tool to investigate its physiological and pathological roles in various tissues and diseases. It has also been targeted by pharmacological agents, such as CGRP antagonists and antibodies, for the treatment of migraine headaches and other conditions associated with CGRP dysfunction.</p>Formula:C163H267N51O49S2Purity:Min. 95%Molecular weight:3,789.3 g/molBQ-610
CAS:<p>BQ-610 is a drug that has been shown to improve brain functions and energy metabolism. It also inhibits the transmission of pain signals in the mesenteric region of rats by blocking voltage-dependent calcium channels. BQ-610 is found to suppress the production of endothelin-a receptor, which is an important regulator for many diseases such as infectious diseases, hypertension, and other cardiovascular disorders. The drug has also been shown to reduce oxidative stress by inhibiting cell nuclei and reducing inflammation by inhibiting basic protein synthesis. BQ-610 has been shown to be effective against congestive heart failure in rats by increasing blood flow and improving biochemical properties.</p>Formula:C36H44N6O6Purity:Min. 95%Molecular weight:656.79 g/molHepcidin-22 (Human)
CAS:<p>Hepcidin product containing the disulfide Bonds: Cys4-Cys20, Cys7-Cys10, Cys8-Cys16, and Cys11-Cys19 and available in the trifluoroacetate salt form. Hepcidin-22 is a variant of the peptide hormone hepcidin-25, which plays an important role in the regulation of iron metabolism in the body. Hepcidin is produced by the liver and is secreted into the bloodstream.<br>Hepcidin binds to ferroportin, a protein that facilitates the export of iron from cells into the bloodstream, and to inhibit its activity.<br>The biological significance of hepcidin-22 is still being studied, but it may play a role in the regulation of iron metabolism in certain situations, such as inflammation or certain disease states. Both hepcidin-22 and hepcidin-25 are targets for the development of treatments for iron-related disorders, such as anemia of chronic disease and hemochromatosis.</p>Formula:C99H151N29O25S9Purity:Min. 95%Molecular weight:2,436.06 g/molSuc-Phe-Ala-Ala-Phe-pNA
CAS:<p>Suc-Phe-Ala-Ala-Phe-pNA is an amino acid that is a substrate for the serine protease myroilysin. It is used in biochemical research to investigate the physiological function of myroilysin. Suc-Phe-Ala-Ala-Phe-pNA has been shown to be an irreversible inhibitor of myroilysin and inhibits enzyme catalysis.</p>Formula:C34H38N6O9Purity:Min. 95%Molecular weight:674.70 g/molMyelin Basic Protein (87-99)
CAS:<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>Formula:C74H114N20O17Purity:Min. 95%Molecular weight:1,555.86 g/molMOG (Rat, Mouse, 35-55)
CAS:<p>Amino acids 35-55 derived from the Immunogenic Myelin Oligodendrocyte protein (MOG). Produced by oligodendrocytes, MOG is an integral part of the oligodendrocyte surface membrane, located in the central nervous system (CNS) and plays an important role in the maintenance and disintegration of the myelin sheath. Unique within their immunoglobulin superfamily, MOG is composed of a transmembrane hydrophobic domain, an extracellular immunoglobulin variable (IgV) domain, a short cytoplasmic loop and within the membrane bilayer there is a second hydrophobic region and after this, a cytoplasmic end. In addition to 218 amino acids of the mature MOG protein, it contains a 29 amino acids long signal peptide.<br>MOG has not only been found to be expressed in the CNS but also at low levels in the peripheral nervous system. Generally MOG is expressed during myelination and functions to maintain the myelin sheath’s structurally integrity through mediating interactions between the myelin and the immune system. This is possible due to its adhesion characteristics and its external location which makes it accessible to antibodies and T-cells. Furthermore is has been suggested that MOG is involved in regulating oligodendrocyte microtubule stability and it can be used as a differentiation marker for oligodendrocyte maturation.Myelin forms a lipid layer around neurons which insulates them. MOG has immunodmainant epitopes: 1-22; 35-55 and 92-106 and this is located at the dimer interface which is formed by MOG IgV domains forming a dimer. These MOG epitopes are recognized by encepalitogenic T cells as foreign antigens. As a result demyelination occurs and this happens in the disease state of Multiple Sclerosis (MS).<br>As MOG is associated with inflammatory demyelinating diseases within the CNS such as neuromyelitis optica spectrum disorders and acute disseminated encephalomyelitis, this MOG (35-55) product can be used to induce these disease states in animal models.<br>One-Letter Formula: MEVGWYRSPFSRVVHLYRNGK</p>Formula:C118H177N35O29SPurity:Min. 95%Molecular weight:2,581.95 g/molCpp-AAF-pAb
CAS:<p>Cpp-AAF-pAb is a synthetic peptide that corresponds to the amino acid sequence of the C terminus of human basic fibroblast growth factor (bFGF) and has been shown to have a variety of effects on cells. It has been used in cell culture studies to measure the effect of bFGF on renal blood flow, which is an important marker for kidney disease. In addition, this peptide inhibits tumor cell growth and has antinociceptive properties in rats. The inhibition of tumor cell growth may be due to its ability to inhibit metalloendopeptidases and polyclonal antibodies.</p>Formula:C32H36N4O7Purity:Min. 95%Molecular weight:588.67 g/molH-Ser-Phe-Leu-Leu-Arg-Asn-NH2
CAS:<p>This is a monoclonal antibody that binds to the alpha-integrin receptor. The alpha-integrin receptor is an integrin that is involved in cell adhesion and migration, as well as the activation of several signaling pathways. This antibody has been shown to inhibit the binding of alpha-integrins to phospholipid membranes, which may be due to inhibition of protein kinase C (PKC). This antibody also inhibits thrombin receptor activation and dextran sulfate-induced cytosolic calcium mobilization.</p>Formula:C34H57N11O8Purity:Min. 95%Molecular weight:747.9 g/molTAT (47-57) TFA salt
CAS:<p>Amino acids 47-57 of the Human Immunodeficiency Virus (HIV) viral coat trans-activator of transcription protein (TAT protein). TAT is a cell penetrating peptide meaning it has the ability to transport itself across cell membranes and into a cell's nucleus independently. Cell penetrating peptides (CPPs) can be used to carry other molecules into the cell and therefore can be used in many applications. Such applications may include: drug delivery, where small drug peptides or nucleic acids can be delivered into target cells or where CPPs are conjugated to imaging agents such as fluorescent dyes or radiolabeled molecules they can be used for in vivo or in vitro imaging in diagnostics. <br>This product is available as a trifluroacetate salt.</p>Formula:C64H118N32O14Purity:Min. 95%Molecular weight:1,559.86 g/molLeupeptin hemisulphate salt monohydrate (Synthetic)
CAS:Leupeptin is a naturally occurring protease inhibitor that has been synthetically produced for use as an experimental tool. Leupeptin inhibits the activity of basic proteins and enzymes by binding to them at the active site, preventing their access to substrate. This inhibition can be reversed with reducing agents (e.g., dithiothreitol). Leupeptin has been shown to inhibit neuronal death during anoxia in experimental models and has also been shown to have neurotrophic effects, which may be due to its ability to prevent protein aggregation.Formula:C20H38N6O4•(H2SO4)0•H2OPurity:Min. 95%Molecular weight:493.61 g/molAcetyl-Myelin Basic Protein (Human, Porcine, Rat, 1-11)
CAS:<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur. This can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contributes to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased in and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>Formula:C52H88N22O17Purity:Min. 95%Molecular weight:1,293.42 g/molCyclo(Arg-Ala-Asp-D-Phe-Cys)
CAS:<p>Cyclo(Arg-Ala-Asp-D-Phe-Cys) is a peptide macrocycle with the amino acid sequence Arg-Ala-Asp-D-Phe-Cys. RGD peptides are biologically active peptides that have been shown to be useful in the treatment of various conditions, including angiogenesis and cancer. Cyclo(Arg-Ala-Asp-D-Phe-Cys) is a cyclic peptide composed of nine amino acids, where each amino acid has one chiral center. This results in two possible stereoisomers (mirror images) for the molecule. The biological activity of this compound has yet to be fully determined.</p>Formula:C25H36N8O7SPurity:Min. 95%Molecular weight:592.67 g/molBoc-D-Ile-OH • 1/2 H2O
CAS:<p>Boc-D-Ile-OH is a cyclohexanone that can be used in peptide synthesis. It has been shown to have affinity for the Tools for Peptide Synthesis and is able to activate primary tumors with metastasis. Boc-D-Ile-OH has been shown to have kinetic parameters, and its pharmacophores are characterized by an organic chemistry approach. This compound is a serine protease inhibitor that blocks the activity of other serine proteases such as chymotrypsin and trypsin.</p>Formula:C13H21NO4H2OPurity:Min. 95%Molecular weight:240.3 g/molIberiotoxin
CAS:<p>Iberiotoxin a synthetic scorpion toxin sourced from the Buthus tamulus scorpion, has disufide bonds formed between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. This prodict can be used as a Ca2+-Activated K+ Channel Blocker (Maxi-K+ Channel Blocker). This peptide can be used in pharmacological studies to investigate the effects of Iberiotoxin on various ion channels and receptors.</p>Formula:C179H274N50O55S7Purity:Min. 95%Molecular weight:4,230.8 g/molFmoc-Phe-OH
CAS:<p>Fmoc-Phe-OH is a natural compound that has been shown to have antimicrobial properties. The biological properties of Fmoc-Phe-OH are not well understood, but it has been shown to have anticancer effects in some cases and to inhibit axonal growth when combined with the protein laminin. Fmoc-Phe-OH can be synthesized by the reaction of pheine with trifluoroacetic acid followed by treatment with h9c2 cells. The analytical method for determining the concentration of Fmoc-Phe-OH is based on intramolecular hydrogen exchange between hydrogen atoms on the amide group and hydrogens on neighboring methylene groups. This process releases heat, which is detected by a thermometer.<br>END></p>Formula:C24H21NO4Purity:Min. 98.0 Area-%Molecular weight:387.44 g/molAc-Nle-Cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2
CAS:<p>Ac-Nle-Cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, also known as cycloastragenol, is a synthetic cyclic peptide that inhibits the activity of adipose β3 adrenergic receptors, leading to reduced fat accumulation. Cycloastragenol has been shown to inhibit the formation of atherosclerotic lesions in mice and may have antiatherogenic effects. It also has been shown to inhibit tumor growth in some skin cancer models and has immunosuppressive effects.</p>Formula:C50H69N15O9Purity:Min. 95%Molecular weight:1,024.2 g/molBoc-Lys(Z)-OH
CAS:<p>Boc-Lys(Z)-OH is an amino acid that is used as a building block for peptide synthesis. It can be used to synthesize Boc-protected L-amino acids, which are useful in the chemical synthesis of peptides and proteins.</p>Formula:C19H28N2O6Purity:Min. 95%Molecular weight:380.44 g/molAc-Leu-Leu-Nle-H (Aldehyde)
CAS:<p>Ac-Leu-Leu-Nle-H (Aldehyde) is a Toll-like receptor ligand that is active against bowel disease. Aldehyde has been shown to have chemotherapeutic effects in vitro and in vivo, even at low doses. It also inhibits the growth of certain cancer cells by inducing apoptosis, which may be due to its ability to activate the nuclear factor kappa B/Toll-like receptor pathway. This agent has been shown to bind to DNA, inhibit transcription, and induce programmed cell death. Aldehyde also binds to proteins that are involved in protein synthesis and cell division. These properties make it useful for the treatment of infectious diseases and cancer.</p>Formula:C20H37N3O4Purity:Min. 95%Molecular weight:383.54 g/mol(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu
CAS:<p>(3,5-Difluorophenylacetyl)-Ala-Phg-OtBu is a secretase inhibitor that inhibits the enzyme that cleaves amyloid precursor protein (APP) to release beta-amyloid. It has been shown to prevent the formation of plaques in the brain and may be used to treat Alzheimer's disease. (3,5-Difluorophenylacetyl)-Ala-Phg-OtBu has also been shown to inhibit the production of tumor necrosis factor alpha (TNFα), which is involved in inflammation and carcinogenesis. The drug has been shown to reduce myocardial infarct size by preventing cardiac cell death and reducing inflammation following a heart attack. It is also active against multiple types of cancer cells, including carcinoma cell lines and multidrug resistant cells.</p>Formula:C23H26N2O4F2Purity:Min. 95%Molecular weight:432.47 g/mol[Arg8]-Vasopressin
CAS:<p>Vasopressin is a peptide antidiuretic hormone, originating from the hypothalamus, that regulates water balance in the body. It is also known as arginine vasopressin or antidiuretic hormone (ADH). The clinical efficacy of vasopressin has been evaluated using in vitro methods on mouse monoclonal antibody production cells, blood sampling, and microdialysis probes for monitoring blood pressure. This product is available in the salt form: Acetate.</p>Formula:C46H65N15O12S2Purity:Min. 95%Molecular weight:1,084.25 g/molCGRP (Rat)
CAS:<p>CGRP (Rat) product with the disulfide Bonds: Cys2-Cys7 and available as a 0.1 mg vial. CGRP is the calcitonin gene-related peptide (CGRP), a neuropeptide that plays an important role in the regulation of vascular tone and blood flow, as well as pain perception, inflammation, and neurogenic inflammation. It is a potent vasodilator and has been implicated in a wide range of physiological and pathophysiological processes.<br>This product has the potential for use in the study of the physiological and pathological roles of CGRP and to investigate the effects of CGRP on blood vessels, neurons, and other tissues. It has also been used to develop models of migraine headaches and other conditions associated with CGRP dysfunction.</p>Formula:C162H262N50O52S2Purity:Min. 95%Molecular weight:3,806.2 g/molAc-Leu-Leu-Met-H (Aldehyde)
CAS:<p>Ac-Leu-Leu-Met-H (Aldehyde) is a tetrazolium dye that is used as a biological stain for the detection of bacteria in infectious diseases. It binds to toll-like receptor 4 on macrophages and other cells, which triggers a cascade of events leading to bacterial cell lysis. Aldehyde also has been shown to be an autophagy inducer and can cause neuronal death when administered in high doses.</p>Formula:C19H35N3O4SPurity:Min. 95%Molecular weight:401.57 g/molH-Val-Lys-Gly-Ile-Leu-Ser-NH2
CAS:<p>H-Val-Lys-Gly-Ile-Leu-Ser-NH2 is a biologically active peptide. It is a peptide that is derived from the amino acid sequence of protease activated receptor 2 (PAR2) and has been shown to induce coagulation. This peptide has also been shown to have cardiovascular effects, such as reducing blood pressure, and may be useful in the treatment of hypertension.</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.79 g/molCamostat Mesilate
CAS:<p>Camostat mesilate is a prodrug that is metabolized to the active form, pemastatin. It is used for the treatment of bowel disease and squamous cell carcinoma. Camostat mesilate inhibits the TNF-α receptor by binding to its response element in vitro and in vivo. The biological properties of camostat mesilate are due to its ability to inhibit TNF-α production by binding to the TNF-α receptor, thereby preventing activation of transcription factors such as nuclear factor kappa B (NFκB). In vitro assays have shown that camostat mesilate induces apoptosis in human carcinoma cell lines through inhibition of growth factor-β1. This drug has also been shown to be effective in treating viral infections, including HIV and herpes zoster.</p>Formula:C20H22N4O5•CH3SO3HPurity:Min. 95%Molecular weight:494.5 g/mol[D-Arg1,D-Phe5,D-Trp7,9,Leu11]-Substance P
CAS:Substance P is a neuropeptide that belongs to the Feeding Regulatory Peptides family. It is synthesized in the hypothalamus and secreted by neurons in the spinal cord, brainstem, and gut. Substance P has been shown to regulate feeding behavior through its interaction with opioid receptors and the release of other neurotransmitters. The synthetic form of this peptide has been shown to reduce body fat in animal models and increased sensitivity to insulin in diabetic patients. This peptide also reduces camp levels in rats, which may be due to its ability to stimulate secretion of camp from pancreatic cells.Formula:C79H109N19O12Purity:Min. 95%Molecular weight:1,516.87 g/molBoc-Asn-OH
CAS:<p>Boc-Asn-OH is a glycopeptide that has a basic structure. It is soluble in water and hydrochloric acid. Boc-Asn-OH has been shown to have antibacterial activity against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, as well as good solubility in organic solvents such as chloroform and acetonitrile. Preparative high performance liquid chromatography (HPLC) of Boc-Asn-OH reveals an amide, toxicity studies, proton, oligosaccharides, disulfide bond, thp-1 cells, conformational properties, esters hydrochloride.</p>Formula:C10H19NO4Purity:Min. 95%Molecular weight:232.23 g/molZ-Leu-Leu-Glu-MCA
CAS:<p>L-Leu-Leu-Glu-MCA is a research tool that activates the receptor. It is a ligand that binds to the receptor, activating it. L-Leu-Leu-Glu-MCA is a small molecule that has been shown to be an antagonist of ion channels in cell biology. It has been shown to inhibit protein interactions and peptide synthesis by inhibiting the binding of ATP. L-Leu-Leu-Glu-MCA also acts as an inhibitor of ion channels and high purity protein interactions, which may be due to its competitive inhibition of ATP binding. Ligands are used in pharmacology for studying protein interactions or inhibiting enzyme activity. The CAS No. for this compound is 348086-66-8.</p>Formula:C35H44N4O9Purity:Min. 95%Molecular weight:664.75 g/molBoc-D-Leu-OH • H2O
CAS:<p>Boc-D-Leu-OH • H2O is an intramolecular hydrogen. It has a helical structure and forms hydrogen bonds with other molecules. Boc-D-Leu-OH • H2O is a cyclic peptide with a hydrophobic side chain and a hydrophilic head group. The peptide has been shown to have antimicrobial activity in the biliary and intestinal tract, as well as chronic pain relief properties. Boc-D-Leu-OH • H2O was found to be effective in animal studies for neuropathic pain, which may be due to its amide structure. A silico analysis revealed that the drug substance had a high binding affinity for the mu opioid receptor and could potentially be used to treat chronic pain caused by inflammation.</p>Formula:C11H21NO4•H2OPurity:Min. 95%Molecular weight:249.31 g/molBNP-45 (Rat)
CAS:<p>BNP-45 is a peptide that binds to the beta-subunit of the Na+/K+ ATPase, inhibiting its activity. It is a potent inhibitor of the enzyme and has been used in research as a tool to study ion channels and receptor activation.<br> BNP-45 has been shown to inhibit ion-channel activity by binding to the beta subunit of the Na+/K+ ATPase. This inhibition leads to an increase in intracellular sodium and calcium levels, which may result in a variety of physiological effects.</p>Formula:C213H349N71O65S3Purity:Min. 95%Molecular weight:5,040.7 g/molOmega-Conotoxin MVIIC
CAS:<p>Omega-Conotoxin MVIIC is a peptide that binds to the nicotinic acetylcholine receptor and activates it, leading to inhibition of neurotransmitter release. It is used as a research tool for studying the pharmacology of ion channels and their ligands. Omega-Conotoxin MVIIC is purified from Conus magus venom. The peptide has been shown to be an inhibitor of potassium channels in rat cortical neurons. CONOTOXINS are small peptides that bind to the nicotinic acetylcholine receptor and activate it, leading to inhibition of neurotransmitter release. They are used as research tools for studying the pharmacology of ion channels and their ligands. CONOTOXINS are purified from Conus magus venom. The peptide has been shown to be an inhibitor of potassium channels in rat cortical neurons.END> END></p>Formula:C106H178N40O32S7Purity:Min. 95%Molecular weight:2,749.3 g/molPhosphoramidon
CAS:<p>Phosphoramidon is a phosphonate compound that inhibits the binding of two enzymes, cholinesterase and butyrylcholinesterase. It has been shown to cause a bronchoconstrictor response in mice, inhibit mesenteric enzyme activities, and inhibit cardiac enzyme activity in rats. Phosphoramidon is used as an experimental drug for treatment of myocardial infarcts. It also has an effect on the central nervous system by acting on neurokinin-1 receptors and kappa-opioid receptors.<br>Phosphoramidon is a monosodium salt with biochemical properties similar to those of other members of this class of drugs.</p>Formula:C23H32N3O10P•2Na•2H20Purity:Min. 95%Molecular weight:623.5 g/molH-QELGKYEQYIKWPWY-OH TFA salt
<p>Peptide H-QELGKYEQYIKWPWY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C100H133N21O24Molecular weight:2,031.27 g/molH-IPFAMQMAY-OH
<p>Peptide H-IPFAMQMAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C50H72N10O11S2Molecular weight:1,071.31 g/molH-GVLTESNKK-OH
<p>Peptide H-GVLTESNKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C41H72N12O14Molecular weight:975.1 g/molH-PGPSDTPILPQ-OH TFA salt
<p>Peptide H-PGPSDTPILPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C50H78N12O16Molecular weight:1,121.24 g/molH-FADLSEAANR-OH
<p>Peptide H-FADLSEAANR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C46H70N14O16Molecular weight:1,093.15 g/molFibrin knob B mimic peptide
<p>Fibrin knob B mimic peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C41H62N14O9Molecular weight:913.03 g/molΒ-sheet peptide monomer
<p>Β-sheet peptide monomer is a synthetic β-sheet forming peptides show promise as anti-microbials. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C34H44N10O4Molecular weight:674.79 g/molH-SLLQLLIGL-OH
<p>Peptide H-SLLQLLIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C46H82N10O11Molecular weight:969.22 g/molH-PSKPSKRSFIEDLLF-OH
<p>Peptide H-PSKPSKRSFIEDLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C82H128N20O22Molecular weight:1,764.03 g/molH-CSNLLLQYGSFCTQL-OH
<p>Peptide H-CSNLLLQYGSFCTQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C74H114N18O22S2Molecular weight:1,689.95 g/molH-YEEK-OH
<p>Peptide H-YEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C25H35N5O9Molecular weight:567.59 g/molDHTGFLTEYVATR
<p>Peptide DHTGFLTEYVATR is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C67H98N18O21Molecular weight:1,509.62 g/molP53 tumor suppressor peptide fragment
<p>P53 tumor suppressor peptide fragment is a peptide fragment for the tumor suppressor protein p53. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C60H98N14O12Molecular weight:1,225.52 g/molH-LQIWDTAGQER-OH
<p>Peptide H-LQIWDTAGQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C57H87N17O18Molecular weight:1,316.42 g/molH-LGAENSVAY-OH TFA salt
<p>Peptide H-LGAENSVAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C40H60N10O14Molecular weight:922.98 g/molH-SPRRARSVA-OH TFA salt
<p>Peptide H-SPRRARSVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C40H72N18O11Molecular weight:999.13 g/molCDK16 peptide substrate
<p>CDK16 peptide substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C52H95N17O11Molecular weight:1,152.43 g/molH-QQLIRAAEIRASANL-OH TFA salt
<p>Peptide H-QQLIRAAEIRASANL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C70H122N24O21Molecular weight:1,653.88 g/molH-GIGILTV-OH
<p>Peptide H-GIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C31H55N7O8Molecular weight:671.83 g/molElav-like gene peptide
<p>Elav‐like gene peptide is a peptide implicated in AUUUA‐mediated mRNA decay. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C50H87N15O17Molecular weight:1,188.33 g/molMHC-I peptide
<p>MHC-I peptide is an antigen-specific IFN-γ producing CD8+ T response peptide. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C96H136N20O21Molecular weight:1,924.24 g/molH-GVYYPDKVFR-OH
<p>Peptide H-GVYYPDKVFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C60H84N14O14Molecular weight:1,243.41 g/molAnnexin A5 peptide
<p>Annexin A5 peptide can be used in early detection of lung adenocarcinoma. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C61H91N17O19Molecular weight:1,384.49 g/molH-VYDPLQPEL-OH TFA salt
<p>Peptide H-VYDPLQPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C50H74N10O15Molecular weight:1,073.2 g/molH-PRRVRLK-OH
<p>Peptide H-PRRVRLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C40H75N17O7Molecular weight:924.15 g/molH-IIPGGAAAQDGR-OH TFA salt
<p>Peptide H-IIPGGAAAQDGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C47H78N16O15Molecular weight:1,125.24 g/molH-FPLKRHDKVDDLSK-OH
<p>Peptide H-FPLKRHDKVDDLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C76H122N22O21Molecular weight:1,697.93 g/molH-SCDTPPPCPR-OH TFA salt
<p>Peptide H-SCDTPPPCPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C43H67N13O14S2Molecular weight:1,072.22 g/molΒ-sheet amyloid aggregate peptide
<p>Β-sheet amyloid aggregate peptide is a short peptide that has been shown to form β-sheet amyloid aggregates in vitro. Proteins that contain such sequences are likely to be problematic for a cell, due to their potential to aggregate into toxic structures. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C43H76N14O13Molecular weight:1,015.16 g/molH-LQEEDAGEYGCMVDGAR-NH2 TFA salt
<p>Peptide H-LQEEDAGEYGCMVDGAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C74H113N21O29S2Molecular weight:1,842.96 g/molExtensin peptide fragment
<p>Extensin peptide fragment is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C33H39N5O7Molecular weight:635.71 g/molTau Conotoxin CnVA
CAS:<p>Tau Conotoxin CnVA is a peptide toxin derived from the venom of the cone snail. It has been shown to be a receptor agonist and to cause pain. Tau Conotoxin CnVA is a disulfide-rich peptide that has been shown to have neurotoxic effects in mammalian cells.</p>Formula:C72H116N24O17S4Purity:Min. 95%Molecular weight:1,718.13 g/molH-D-Ala-D-Nal(2')-Ala-Trp-D-Phe-Lys-NH2
<p>H-D-Ala-D-Nal(2')-Ala-Trp-D-Phe-Lys-NH2 is a Growth-Hormone Secretagogue (GHS) receptor agonist which usually associates with the peptide hormone, Ghrelin to stimulates growth hormone release from the anterior pituitary gland and stimulate food intake.</p>Formula:C45H55N9O6Purity:Min. 95%Molecular weight:818 g/molsCD40 Mouse
<p>sCD40 Mouse is a peptide that is used as a research tool to study the activation of CD40, an antibody that is used to activate CD40. sCD40 Mouse is an activator of CD40 and can be used in the inhibition of ion channels and protein interactions. It has a CAS number (1237-63-6) and acts as a ligand for receptor. sCD40 Mouse can be used in pharmacology to study protein interactions.</p>Purity:Min. 95%SIVmac239 - 52
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,765.9 g/molAc-Leu-Arg-Ser-Arg-AMC
<p>Interleukin-1 (IL-1) is a protein that is involved in the regulation of many aspects of the immune system. IL-1 is produced by macrophages and other cells, and it stimulates the production of other cytokines and has anti-inflammatory effects. IL-1 can also stimulate the release of certain enzymes such as elastase from neutrophils, which may have a role in chronic inflammatory diseases. Interleukin 1 has been shown to be an MALT1 substrate, a protein that regulates Mucosa Associated Lymphoid Tissue lymphoma translocation protein (MALT). The MALT1 enzyme is involved in regulating inflammation and immunity, as well as tumor progression.</p>Formula:C33H51N11O8Purity:Min. 95%Molecular weight:729.84 g/molH-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is used to immobilize amino acids, thiols, and other building blocks in order to synthesize peptides. This resin can be used for a variety of applications, including the synthesis of small organic molecules, oligonucleotides, and polysaccharides. H-Thr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB has been shown to react with amines and thiols.</p>Purity:Min. 95%H-SLHTLFGDK^-OH
<p>Peptide H-SLHTLFGDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPVITGAPYEYR^-OH
<p>Peptide H-TPVITGAPYEYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclo[Arg-Gly-Asp-D-Tyr-Lys(PEG)]
Cyclo[Arg-Gly-Asp-D-Tyr-Lys(PEG)] is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.Formula:C33H52N10O11Purity:Min. 95%Molecular weight:764.84 g/molH-Arg(Pbf)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Arg(Pbf)-2-ClTrt-Resin (200-400 mesh) 1% DVB is an alcohol resin that is used as a building block in peptide synthesis. It can be used with other alcohol resins, amines and thiols to synthesize peptides. The resin is also compatible with a variety of functional groups including carboxylic acids, amino acids and thiols. H-Arg(Pbf)-2-ClTrt-Resin (200-400 mesh) 1% DVB has been shown to be effective in the synthesis of peptides containing Arg, Lys, Trp and Tyr. This resin is soluble in organic solvents such as dichloromethane and ether.Purity:Min. 95%Myelin PLP (57-70)
Myelin PLP (57-70) is a peptide that is immunogenic and biochemically active. It has been shown to have immunogenic properties and can be used as an adjuvant for vaccines. Myelin PLP (57-70) is a peptide fragment of myelin basic protein that has been shown to be immunogenic in animal models. It induces an antibody response against myelin basic protein, which can be used for the treatment of multiple sclerosis. 6-Fluoro-3-indoxyl-beta-D-galactopyranoside Tilmicosin 3-Desacetylcefotaxime potassium Gatifloxacin Myelin PLP (57-70)Formula:C87H122N18O22Purity:Min. 95%Molecular weight:1,772.05 g/molH-SSLLDVLAAR^^-OH
<p>Peptide H-SSLLDVLAAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAVGVGK^SA-OH
<p>Peptide H-GAVGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Degarelix acetate
CAS:Controlled ProductSynthetic peptide used in treatment of prostrate cancerFormula:C82H103ClN18O16(C2H4O2)xPurity:Min. 98 Area-%Color and Shape:White/Off-White SolidMolecular weight:1,632.26 g/molH-IVPNVLLEQGK^-OH
<p>Peptide H-IVPNVLLEQGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α-Defensin-4 (Human)
<p>Antimicrobial peptide consisting of disulfide bonds between Cys2-Cys30, Cys4-Cys19, and Cys9-Cys29. Alpha-defensin-4 is a small, cationic peptide that is part of the alpha-defensin family of antimicrobial peptides in humans. It is primarily produced by neutrophils, which are a type of white blood cell that plays a critical role in the immune response to bacterial infections.<br>Alpha-defensin-4 is known to have broad-spectrum antimicrobial activity against a wide range of bacterial pathogens, including both Gram-positive and Gram-negative bacteria. Like other alpha-defensins, alpha-defensin-4 achieves its antimicrobial activity by disrupting the cell membranes of the pathogens, leading to cell lysis and death.<br>In addition to its antimicrobial activity, alpha-defensin-4 has been found to have other functions in the body, including modulating the immune response and promoting tissue repair. It has also been implicated in the pathogenesis of certain inflammatory and autoimmune diseases, including rheumatoid arthritis and psoriasis.<br>Alpha-defensin-4 is typically found in various bodily fluids, including blood, urine, and semen, and its levels can be used as a diagnostic marker for certain conditions. For example, elevated levels of alpha-defensin-4 in joint fluid can be indicative of a bacterial infection in the joint, which can help to guide treatment decisions.</p>Formula:C157H255N49O43S6Purity:Min. 95%Molecular weight:3,709.4 g/molNeuromedin B, porcine
<p>Peptide Neuromedin B, porcine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C52H73N15O12SMolecular weight:1,132.3 g/molAbz-SDK(Dnp)P-OH trifluoroacetate
CAS:<p>Angiotensin Converting Enzyme (ACE) fluorescent peptide substrate that specifically binds to the N domain of ACE</p>Formula:C31H38N8O13(C2HF3O2)xColor and Shape:PowderMolecular weight:730.70 g/molSIVmac239 envelope - 87
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:2,317.9 g/molProTx-II
CAS:ProTx-II is a synthetic peptide that activates the TRPV1 receptor, a member of the capsaicin receptor family. ProTx-II has been shown to inhibit NGF-induced neurite outgrowth, and can be used as a research tool in studying the structure and function of TRPV1 receptors. ProTx-II is also an inhibitor of protein interactions with the TNF receptor, and has been shown to selectively inhibit NFκB activation by inhibiting IKK kinase activity.Formula:C168H250N46O41S8Purity:Min. 95%Molecular weight:3,826.6 g/molIL 6 Human
<p>IL-6 Human is a recombinant peptide, which belongs to the class of activator. It is an inhibitor that binds to the IL-6 receptor and inhibits IL-6 binding. IL-6 Human has been shown to inhibit protein interactions, such as cytokine receptors and ligands. IL-6 Human may also inhibit ion channels. This product is a research tool for use in life science and cell biology experiments.</p>Purity:>97% By Sds-Page & Rp-Hplc.Ac-ISQAVHAAHAEINEAGR-NH2
<p>Peptide Ac-ISQAVHAAHAEINEAGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLAVYQ^AGAR-OH
Peptide H-CLAVYQ^AGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (457-466)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C47H85N13O15Molecular weight:1,072.28 g/molH-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is a building block that can be used to synthesize peptides. H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is an alcohols, amines, and thiols resin that can be used to synthesize peptides. H-Gln(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB has been shown to react with thiols, alcohols and amines, which are building blocks for peptide synthesis.</p>Purity:Min. 95%H-NIIHGSDSVESAEK^-OH
<p>Peptide H-NIIHGSDSVESAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-S^LSLSPG-OH
Peptide H-S^LSLSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-AKFVAAWTLKA-NH2
Peptide Ac-AKFVAAWTLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Acetyl-Myelin Basic Protein (Mouse, 1-11)
<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur and theses occurrences can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.<br>Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contribute to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.</p>Formula:C53H95N21O18Purity:Min. 95%Molecular weight:1,314.48 g/molH-V^V^GGLV^ALR^-OH
<p>Peptide H-V^V^GGLV^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Glu(Edans)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(Dabcyl)-OH
<p>H-Glu(Edans)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(Dabcyl)-OH is a peptide and biochemical that belongs to the group of enzyme substrates. It is a nonapeptide that contains an amidated lysine residue at the N terminus and the sequence H-Glu(Edans)-Pro-Leu is repeated. The amidated lysine residue facilitates the attachment of H-Glu(Edans)-Pro-Leu to an enzyme substrate, in this case calpain. H-Glu(Edans)-Pro-Leu binds to calpain by forming a covalent bond with a reactive cysteine residue on the enzyme's active site, thereby inhibiting its activity.</p>Formula:C72H97N17O16SPurity:Min. 95%Molecular weight:1,488.74 g/molDynorphin B
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C74H115N21O17Molecular weight:1,570.8 g/molBrAc-TWPKHFDKHTFYSILKLGKH-NH2
<p>Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:2,604.86 g/molH-QLLAPGNSAGAFLIR^-OH
Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CAEAETAKDN-OH
Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEGIEEFLR^-OH
<p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLGYLEQLLR^-OH
<p>Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AMVSEFLKQAWFIENEEQEYVQTVK-OH
<p>Peptide Ac-AMVSEFLKQAWFIENEEQEYVQTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-PKPPKPVSKMRMATPLLMQA-OH
<p>Peptide Biot-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNFYAWK^-OH
Peptide H-VNFYAWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-GAGSLQPLALEGSLQKRG-OH
<p>Peptide Fluor-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Thr(tBu)-2-ClTrt-Resin (200-400 mesh) 1% DVB
<p>H-Thr(tBu)-2-ClTrt-Resin is an amine resin that is used as a building block for the synthesis of peptides. It is used in conjunction with other resins and chemicals to produce a wide variety of peptides. The resin contains 1% DVB, which improves the solubility and stability of the resin. This product can be used in a variety of applications, including peptide synthesis, protein sequencing, and antibody production.</p>Purity:Min. 95%H-YLAEVATGEK^-OH
<p>Peptide H-YLAEVATGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELHHLQEQNVSNA^FLDK^-OH
<p>Peptide H-ELHHLQEQNVSNA^FLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTAGVSPK^-OH
<p>Peptide H-YTAGVSPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>sgp91 ds-tat Peptide 2, scrambled
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C98H190N50O22SMolecular weight:2,453 g/molH-AL^P^AP^IEK^-OH
<p>Peptide H-AL^P^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SDKNEKSHKYETLNISKC-NH2
<p>Peptide Ac-SDKNEKSHKYETLNISKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVPCEPPEV^-OH
<p>Peptide H-VVPCEPPEV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFSIWEETGLK^-OH
<p>Peptide H-DFSIWEETGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-EDIIRNIARHLAQVGDSMDR-OH
<p>Peptide LCBiot-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSVF^PL^APSSK^-OH
Peptide H-GPSVF^PL^APSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPSTPPTPSPSTPPTPSPSC-NH2
Peptide H-VPSTPPTPSPSTPPTPSPSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Angiotensin I (1-9)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C56H78N16O13Molecular weight:1,183.35 g/molMyr-KFEEERARAKWDT-OH
<p>Peptide Myr-KFEEERARAKWDT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>IL 4 Human
<p>IL 4 is a cytokine that is responsible for the proliferation and activation of B cells, T cells, macrophages and other immune cells. IL 4 binds to the high affinity receptor IL-4Rα. It also activates the membrane bound IL-4Rβ. The IL-4Rα is a heterodimer consisting of an alpha chain, which is shared by all members of the type II cytokine receptor family, and the common beta chain shared by all type I cytokines receptors. IL-4 has been shown to be effective in inhibiting tumor growth in vivo and in vitro.</p>Purity:>98% By Sds-Page And Rp-Hplc.H-FQPTLLTLPR^-OH
<p>Peptide H-FQPTLLTLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVINEAWFPEDQR^-OH
<p>Peptide H-DVINEAWFPEDQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GM CSF Human
GM CSF Human is a protein that belongs to the GM-CSF family. GM-CSF proteins are cytokines that activate neutrophils and macrophages, which play an important role in the immune system. This protein is a potent activator of receptor and peptides, as well as ion channels. It has been shown to inhibit ligand binding to receptors and inhibit the function of antibodies. The antibody can be used as a research tool for Cell Biology or to study the effects of drugs on ion channels. The CAS number for this protein is 57722-07-1.Purity:Min. 95%H-GELNEHLGLLGPYIR^-OH
Peptide H-GELNEHLGLLGPYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-MYWVRQAPGKGLEW-NH2
<p>Peptide Ac-MYWVRQAPGKGLEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[Glu1]-Fibrinopeptide B
Fibrinopeptide B is a peptidic, biologically active peptide with the sequence Glu-Lys-Arg-Val. It is an epitope of the fibrinogen protein and has been reported to be involved in various biological processes such as cell proliferation, inflammation, and coagulation. Fibrinopeptide B is also a mass spectrometry standard for calibrating mass spectrometers. Biochemicals such as peptides and proteins can be identified by using this peptide. Fibrinopeptide B may also play a role in cancer metastasis and atherosclerosis.Formula:C66H95N19O26Purity:Min. 95%Molecular weight:1,570.6 g/molAbz-Gly-Phe-Ser-Pro-Tyr(NO2)-OH
<p>Abz-Gly-Phe-Ser-Pro-Tyr(NO2)-OH is a peptide that can be used as an angiotensin I converting enzyme II substrate. It is a synthetic, non-peptide molecule that has been shown to inhibit the activity of the angiotensin I converting enzyme (ACE). This inhibition prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilation and decreased blood pressure.</p>Formula:C35H39N7O11Purity:Min. 95%Molecular weight:733.74 g/molH-VVAAVGDAVK^-OH
<p>Peptide H-VVAAVGDAVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CLAVYQAGAR^-OH
Peptide H-CLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STVHEILCKLSLEG-NH2
<p>Peptide H-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>8-Azido-3,6-Dioxaoctanoic Acid
CAS:8-Azido-3,6-Dioxaoctanoic Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 8-Azido-3,6-Dioxaoctanoic Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C6H11N3O4Purity:Min. 95%Molecular weight:189.17 g/molGhrelin (Human, 1-14)
Amino acids 1-14 of Ghrelin, a peptide hormone that is found in the stomach, brain and other tissues. Ghrelin associates with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. As a result it is able to influence the body in various ways such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Formula:C76H121N22O24Purity:Min. 95%Molecular weight:1,725.94 g/molFmoc-Acc-Resin
Fmoc-ACC-Resin is a resin for the synthesis of peptides that has been used for the synthesis of Fmoc-protected amino acids and peptides. The resin is a solid support that can be used in automated peptide synthesizers. It can be used in the synthesis of peptides with N-terminal amine or carboxylic acid groups, such as Fmoc-amino acids, Fmoc-NHS esters, and side chain protected amino acids.Purity:Min. 95%H-dPEG®4-Glu[dPEG®4(Cyclo(Arg-Gly-Asp-d-Phe-Lys))]2
H-dPEG®4-Glu[dPEG®4(Cyclo(Arg-Gly-Asp-d-Phe-Lys))]2 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.Formula:C92H150N22O31Purity:Min. 95%Molecular weight:2,060.35 g/molHXB2 gag NO-67
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,803.2 g/molHepcidin-24 (Human)
Consisting of the disulfide Bonds: Cys6- Cys22, Cys9-Cys12, Cys10- Cys18, and Cys13-Cys21 and of the trifluoroacetate salt form, this product can be used as an internal standard for Hepcidin assays.Hepcidin-24 is a peptide hormone that plays a key role in the regulation of iron metabolism in the body. It is produced by the liver and is secreted into the bloodstream, where it interacts with cells in the intestine and other tissues to control the absorption and distribution of iron. Hepcidin acts as a negative regulator of iron uptake and release by binding to and inhibiting the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. When hepcidin levels are high, ferroportin activity is reduced, leading to decreased iron absorption from the diet and reduced iron release from cells. When hepcidin-24 levels are low, ferroportin activity is increased, leading to increased iron absorption and release. Imbalances in hepcidin levels can lead to a variety of disorders, including iron-deficiency anemia, hemochromatosis (an iron overload disorder), and anemia of chronic disease. Therefore, hepcidin-24 is a key target for the development of treatments for these and other iron-related disorders. In addition to its role in iron metabolism, hepcidin has been shown to have antimicrobial properties, as it can inhibit the growth of certain bacteria and fungi. It may also be involved in the regulation of immune function and inflammation.Formula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.31 g/molSARS-CoV-2 Antigen Peptide NCAP (TWLTYTGAIKLDDKDPNF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C97H144N22O30Molecular weight:2,098.43 g/molH-TKQTAR^^-OH
<p>Peptide H-TKQTAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KPVSLSYRCPCR^FFE-OH
<p>Peptide H-KPVSLSYRCPCR^FFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Met-Gly-Pro-AMC·HCl
CAS:<p>H-Met-Gly-Pro-AMC·HCl is a complex organic compound. It is often used as a reagent in organic synthesis, as well as being a useful intermediate for the production of other fine chemicals. H-Met-Gly-Pro-AMC·HCl is useful for producing speciality chemicals and research chemicals, and can be used as a versatile building block.</p>Formula:C22H28N4O5S·HClPurity:Min. 97 Area-%Color and Shape:PowderMolecular weight:497.01 g/molH-Ser-Phe-Phe-Leu-Cit-OH
<p>H-Ser-Phe-Phe-Leu-Cit-OH is a biologically active peptide that has been shown to be a potent activator of the protease-activated receptor 3 (PAR3) and PAR1. PAR3 is a member of the PAR family of G protein-coupled receptors. It has been suggested that this peptide acts as a vasoconstrictor, which might be due to its activation of PAR3 on vascular endothelium and stimulation of the release of endothelin from endothelial cells. This peptide also has been studied for its potential role in hypertension and cardiovascular disease.</p>Purity:Min. 95%H-SFEDIHHYR^-OH
<p>Peptide H-SFEDIHHYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It is a thiol-reactive resin with a pendant amine group. H-Tyr(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is soluble in common organic solvents and can be used for the synthesis of peptides with amino acids containing aromatic rings.Purity:Min. 95%CMVpp65 - 136 (RHRQDALPGPCIAST)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,621.9 g/molH-NTTGAL^TTR-OH
<p>Peptide H-NTTGAL^TTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-K^LVVVGAVG-OH
<p>Peptide H-K^LVVVGAVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2
<p>Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 is a peptide that blocks the melanocortin receptor and inhibits the synthesis of MSH. Cyclo[CO-(CH2)2-CO-D-Nal(2')-Arg-Trp-Lys]-NH2 has been shown to inhibit the growth of cancer cells in culture. It also has antiinflammatory properties and is used for the treatment of skin conditions such as psoriasis and vitiligo.</p>Formula:C40H48N9O7Purity:Min. 95%Molecular weight:766.88 g/molAmyloid beta peptide(1-40) trifluoroxalate - synthetic
CAS:<p>Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serum</p>Formula:C194H295N53O58S·C2HF3O2Purity:Min. 95%Color and Shape:White PowderMolecular weight:4,443.83 g/molH-IFYNQQSHYDGTTGK^-OH
<p>Peptide H-IFYNQQSHYDGTTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFLRRIRPKLK^WDNQ-OH
<p>Peptide H-YGGFLRRIRPKLK^WDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Leuprolide Human
<p>Leuprolide is a synthetic hormone that is used for the treatment of prostate cancer. It works by blocking the production of hormones called luteinizing hormone and follicle-stimulating hormone in the body. Leuprolide is also used to treat endometriosis, uterine fibroids, and early puberty. This drug has been shown to have an inhibitory effect on prostate cancer cells in vitro and in vivo.</p>Formula:C59H84N16O12Purity:Min. 95%Molecular weight:1208.64546H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2
<p>H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 is a peptide that is involved in tumor targeting. This peptide binds to the integrin αvβ3, which is expressed at high levels on the surface of tumor cells and plays an important role in tumor progression. It has been shown to be able to induce apoptosis in cancer cells and inhibit angiogenesis by binding to the RGD motif on integrins. H-[Cys-Arg-Gly-Asp-Arg-Gly-Pro-Asp-Cys]-NH2 also inhibits cell proliferation and induces cell cycle arrest.</p>Formula:C35H58N16O13S2Purity:Min. 95%Molecular weight:975.08 g/molFmoc-Trp-Wang Resin (100-200 mesh) 1% DVB
<p>Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is a peptide resin that is used in the solid phase synthesis of peptides and small molecules. This product has been shown to be an effective inhibitor for Ion channels, Receptor, Ligand, and even Cell Biology. It is also a high purity reagent that can be used in a variety of applications including Pharmacology and Protein interactions. The Fmoc-Trp-Wang Resin (100-200 mesh) 1% DVB is available for purchase with CAS No. 680904-06-4.</p>Purity:Min. 95%Cyclo[Arg-Gly-Asp-D-Phe-Lys(Biotin-PEG-PEG)]
RGD peptide with a Biotin Reporting Tag and PEG Spacers for more efficient binding to Lipid surfaces. This product may require further derivatization before use. The one letter sequence for this peptide is: c(RGDfK(Biotin-PEG-PEG)) where PEG = 8-Amino-3,6-Dioxaoctanoic Acid.Formula:C49H77N13O15SPurity:Min. 95%Molecular weight:1,120.3 g/molH-FPLTNAIK^-OH
<p>Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Mu-Conotoxin GS
<p>A synthetic cone snail toxin, sourced from the marine snail, Conus geographus. This product has disulfide bonds between Cys2-Cys14, Cys9-Cys19, and Cys13-Cys27 and is available as a 0.5mg vial.</p>Formula:C136H226N52O48S7Purity:Min. 95%Molecular weight:3,618.1 g/molMOCAc-Pro-Leu-Gly
CAS:<p>MOCA-Pro-Leu-Gly is a peptide that can bind to the receptor for the neurotransmitter acetylcholine. It is a competitive inhibitor of acetylcholine and has been shown to have an affinity for the nicotinic acetylcholine receptor (nAChR) in vitro. MOCA-Pro-Leu-Gly has been used as a research tool to study protein interactions, as well as to investigate the function of ion channels and receptors. This peptide also has potential therapeutic uses, such as treating Alzheimer's disease by blocking nicotinic acetylcholine receptors in the brain.</p>Formula:C25H31N3O8Purity:Min. 95%Molecular weight:501.53 g/molH-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
<p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C258H401N79O78Molecular weight:5,857.5 g/molH-TANDLNLLILR^-OH
<p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mal-PEG3-Glu[Cyclo(Arg-Gly-Asp-D-Tyr-Lys)]2
<p>A dimeric RGD peptide for click chemistry (PEG3 = 11-amino-3,6,9-Trioxaundecanoic acid). This product is available as a trifluoracetate salt.</p>Formula:C74H107N21O25Purity:Min. 95%Molecular weight:1,690.79 g/molL-Pen(p-Me-Bzl)
<p>L-Penicillamine (L-Pen) is a metabolite of penicillin and is the toxic from of penicillin’s two enantiomers L-Pen and D-Pen. While D-Pen is a clinically useful metal chelator protein with its ability to help treat Wilson’s diseases and possible Alzheimer’s disease, L-Pen can result in neuritis and marrow damage. It is important therefore that methods are developed, particularly in the pharmaceutical industry, to identify and eliminate the presence of L-Pen. One such method is using a chiral molecular imprinting technique.</p>Formula:C13H19NO2SPurity:Min. 95%Molecular weight:253.2 g/molH-Cys(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Cys(Trt)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is an acid-labile thiolated polystyrene resin with a low degree of substitution. The resin has been shown to be stable in the presence of strong acid, and can be used for the synthesis of peptides. This product contains 1% DVB as a protective colloid, which resists hydrolysis by acids and bases.</p>Purity:Min. 95%H-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.4-[D10]Leu-Insulin, human
<p>The insulin receptor is a cell surface receptor that binds the hormone insulin, a peptide hormone. It belongs to the class of tyrosine kinase receptors and is activated by the binding of insulin to its extracellular alpha subunit. Insulin causes an increase in glucose uptake in muscle cells and adipocytes by stimulating the activity of several enzymes involved in carbohydrate metabolism. The insulin receptor also has ion channel activity and can activate potassium channels. Insulin receptors are found on many different cell types, including liver cells, fat cells, and brain cells. The protein is composed of two alpha subunits that form a disulfide bond to create a functional dimer. Insulin receptors have been used as research tools for studying protein interactions, ligands, and pharmacology.END>></p>Formula:C257H343D40N65O77S6Purity:Min. 95%Molecular weight:5,847.8 g/molCyclo(Arg-Gly-Asp-D-Tyr-Cys)
<p>Cyclo(Arg-Gly-Asp-D-Tyr-Cys) is a peptide that is used as a research tool to study the activation of ion channels. It activates the channel by binding to the receptor and inducing conformational changes in it. Cyclo(Arg-Gly-Asp-D-Tyr-Cys) is also used as an inhibitor of protein interactions, such as antibody and ligand interactions. CAS No.: 438286 28</p>Formula:C24H34N8O8SPurity:Min. 95%Molecular weight:594.65 g/molδ-MSH
<p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C74H99N21O16SMolecular weight:1,570.81 g/molH-FFVPPFQQSPR^-OH
Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QFYDQALQQAVVDDDANNAK^-OH
Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GpTX-1 Toxin
<p>GpTX-1 is a synthetic 34 amino acid peptide derived from tarantula spider venom. Due to its antagonist activitiy against voltage gated sodium channels such as Na v1.7, it can be used as a possible therapeutic in inflammatory, neuropathic, visceral and nociceptive pain treatment. DpTX-1 has also been found to block voltage-dependent calcium channels.<br>One-Letter Formula: H-DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2</p>Formula:C176H271N53O45S7Purity:Min. 95%Molecular weight:4,073.9 g/molBoc-L-Glutamic Acid bis-Propargyl Amide
<p>Boc-L-Glutamic Acid bis-Propargyl Amide is a building block for Click Chemistry. It is a white solid that is soluble in DMF, DMSO and other organic solvents. This product can be used as a reagent for peptide synthesis and as an intermediate for the synthesis of amino acids. Boc-L-Glutamic Acid bis-Propargyl Amide reacts with dimethylaminoethanol to form the corresponding amide. It has been shown that this product can be used in click chemistry reactions to form amides and ureas.</p>Formula:C16H23N3O4Purity:Min. 95%Molecular weight:321.3 g/molDes 1-10 Obestatin (Rat, Mouse)
<p>A truncated analog of Obestatin, a 23 amino acid gastrointestinal peptide, encoded for by the ghrelin gene and is known to reduce food intake through supressing appetite. This peptide has been found to influence the pancreas, cardiovascular system and adipose tissues as well as the gastrointestinal system. One study showed that when high-fat diet fed rats were given chronic administration of obestatin it prevented the development of non-alcoholic fatty liver disease. Consequently Obestatin has the potential to be used in preventing obesity-related diseases.</p>Formula:C61H98N22O18Purity:Min. 95%Molecular weight:1,427.6 g/molH-DLPAPITR^-OH
Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-18)
<p>Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-18) is a non-acylated analog of Ghrelin (Human, 1-18), amino acids 1-18 of the peptide hormone Ghrelin. This peptide does not contain the unique N-octanoyl group which is linked to Ghrelin's third serine residue covalently and which allows Ghrelin to associate with the growth hormone secretagogue receptor (GHS-R). Through interaction with the GHS-R, Ghrelin can exert its various effects on the body such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.</p>Formula:C88H143N31O29Purity:Min. 95%Molecular weight:2,099.31 g/molLiver-Expressed Antimicrobial Peptide 2, human
<p>Liver-Expressed Antimicrobial Peptide 2 (LEAP2) is a peptide that belongs to the family of antimicrobial peptides. LEAP2 is a potent activator of ion channels, which are membrane proteins that regulate the passage of ions through the cell membrane. LEAP2 can also inhibit protein interactions by binding to receptors and ligands on the surface of cells. LEAP2 has been shown to be a receptor for Ligand-gated ion channels, which are involved in many cellular processes such as neurotransmitter release, muscle contraction, and hormone release.<br>LEAP2 can be used as an inhibitor of the hyperpolarization activated cyclic nucleotide-gated (HCN) channels in neurons. These channels are important for regulating neuronal excitability and inhibiting neuronal activity following action potentials.</p>Formula:C191H316N64O57S5Purity:Min. 95%Molecular weight:4,581.3 g/molH-Leu-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Leu-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that has been used to synthesize peptides. It can be used as a building block for many other chemical reactions, such as cross-linking and oxidation. This resin is typically used in the synthesis of peptides with an amino acid sequence of H-Leu-2-ClTrt and contains 1% DVB. The resin can be used for the synthesis of small organic molecules, such as antibiotics, with a molecular weight between 500 and 2000 Da.</p>Purity:Min. 95%H-NFLINETAR^-OH
Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ala-Phe(para-Fluoro)-Arg-Cha-Cit-Tyr-NH2
<p>H-Ala-Phe(para-Fluoro)-Arg-Cha-Cit-Tyr-NH2 is a peptide that has been shown to activate Protease Activated Receptor 1 (PAR1). PAR1 is the receptor for thrombin, which is the enzyme responsible for blood clotting. The peptide was found to be a potent activator of PAR1 in vitro and in vivo. It has also been shown to inhibit the production of angiotensin II, which can lead to hypertension. H-Ala-Phe(para-Fluoro)-Arg-Cha-Cit-Tyr-NH2 is a potential candidate for treating cardiovascular diseases such as hypertension.</p>Formula:C42H63N12O8FPurity:Min. 95%Molecular weight:883.04 g/molH-YLWEWASVR^-OH
<p>Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyclorasin 12A
<p>Cyclorasin 12A is a research tool that can be used to activate or block ligands on their receptors. Cyclorasin 12A is a peptide fragment of cyclosporin A, which is an immunosuppressive agent. Cyclorasin 12A binds to the receptor, which activates the ion channels and inhibits the activity of protein kinases. Cyclorasin 12A has been shown to inhibit ion channels in cells and also has been found to reduce inflammation by inhibiting cytokine production.</p>Formula:C71H102N27O11FPurity:Min. 95%Molecular weight:1,528.78 g/molFGF 2 Mouse
<p>FGF-2 is a protein that belongs to the FGF family. It is an activator of erythropoietin, which stimulates the production of red blood cells. FGF-2 also acts as a ligand for FGFR1 and FGFR2, which are receptors for FGF-2. The binding of FGF-2 to these receptors leads to a cascade of cellular responses by activating different types of ion channels and proteins involved in cell proliferation and differentiation. This protein is purified from mouse sources with high purity and no detectable endotoxin levels.</p>Purity:Min. 95%H-Met-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Met-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is a new, high yielding building block for the production of peptides by solid phase synthesis. The resin can be used as a building block for the synthesis of amines, alcohols, and thiols.</p>Purity:Min. 95%Boc-Asp(OBzl)-Pro-Arg-MCA
CAS:<p>Boc-Asp(OBzl)-Pro-Arg-MCA is a peptide that can activate the receptor GPRC6A. The peptide has been shown to activate the receptor by binding to it and activating the signal transduction pathway. This peptide is also an inhibitor of ion channels, such as voltage-gated potassium channels. Boc-Asp(OBzl)-Pro-Arg-MCA is a high purity product with CAS No. 113866-00-5.</p>Formula:C37H47N7O9Purity:Min. 95%Molecular weight:733.81 g/molAmino-dPEG®4-t-Butyl Ester
CAS:<p>Amino-dPEG®4-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C15H31NO6Purity:Min. 95%Molecular weight:321.41 g/molBiotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C171H254N44O49S5Purity:Min. 95%Molecular weight:3,870.44 g/molFeleucin-B01
<p>Feleucin-B01 was recently identified from the skin secretion of the toad Bombina orientalis with a role in preventing the host from bacterial infection. Synthetic feleucin-B01 shows limited antimicrobial activity against a reference Gram-positive bacterium and is ineffective against the Gram-negative and yeast strains. The mode of action of the non-apeptide is lysis of the bacterial membrane resulting in rapid bacterial death. Feleucin-B01 shows a limited role in the secreted host defences which is complemented by the range of alternate antimicrobial peptides (AMP) also excreted. The amphipathic feleucin-B01 sequence is being studied as a template to hopefully generate more potent synthetic versions with a broader range of activity.</p>Molecular weight:931.17 g/molpp89 phosphoprotein fragment [Mouse cytomegalovirus 1]
<p>Cytomegalovirus (CMV) is a prevalent human pathogen of concern in the immunocompromised such as during organ transplant or in AIDs patients- it can potentially be fatal. Due to the commonness of CMV, one strategy being developed is prevention of viral reactivation in immunosuppressed groups. Current antivirals have significant toxicity thus pushing the search for a specific CMV therapy.Murine CMV has been well established as a model for human CMV, including its susceptibility to T cell mediated clearance. The immediate-early protein 1 (IE1) was fragmented and used to find the best IE1 epitope as a vaccine. YPHFMPTNL, provided here, recognized by H-2 Ld-restricted CD8+ T cells was the best epitope of IE1 for T cell recognition. The fragment has been used to successfully generate CD8+ T cell clones specific for the IE1 epitope of murine CMV. This peptide has the potential to further the development of antiviral immunotherapy for CMV and better understand its ability to evade the host immunity.</p>Molecular weight:1,118.5 g/molAlloferon 2
<p>Alloferon 2, a member of the Alloferons was extracted from the blood of a Callifora vicina fly who had been experimentally infected. The Alloferons are, bioactive, cationic peptides and can stimulate Natural Killer cell activity and IFN synthesis.</p>Molecular weight:1,127.5 g/mol
