
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30316 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-FSGVPDR^-OH
<p>Peptide H-FSGVPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLPVPQK^-OH
Peptide H-VLPVPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNQEVLEFVTSGGR^-OH
<p>Peptide H-SNQEVLEFVTSGGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pexiganan
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C122H210N32O22Molecular weight:2,477.21 g/molH-R^EQAPNLVY-OH
<p>Peptide H-R^EQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LTRIV-NH2
<p>Peptide Ac-LTRIV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIFGLFGK^-OH
<p>Peptide H-VIFGLFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HNLFEPEDTGQR^-OH
Peptide H-HNLFEPEDTGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQTAHIVLEDGTK^-OH
<p>Peptide H-AQTAHIVLEDGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLVIQGDER^-OH
Peptide H-YLVIQGDER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SATWLALSRIAGLCNRAVFQ-NH2
<p>Peptide H-SATWLALSRIAGLCNRAVFQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 115 (KAESTVAPEEDTDED)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,635.6 g/molH-YNLNSFGLRY-NH2
<p>Peptide H-YNLNSFGLRY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FTISADTSK^-OH
Peptide H-FTISADTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HER-2/neu 689-697 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-FPLTSFR^-OH
<p>Peptide H-FPLTSFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 84
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,613 g/molH-VDFTLSSER^-OH
Peptide H-VDFTLSSER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AHVQVVDSNGNR^-OH
<p>Peptide H-AHVQVVDSNGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRKKWNKWALSR-NH2
Peptide H-FRKKWNKWALSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Vitamin D Receptor (VDR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolTyrosinase precursor (1-9)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-VVGARGVGK^-OH
<p>Peptide H-VVGARGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QQRFEWEFEQQ-NH2
Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C72H98O22N20Molecular weight:1,595.7 g/molAc-PWRPSHPVWMPT-NH2
<p>Peptide Ac-PWRPSHPVWMPT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,531.8 g/molHXB2 gag NO-91/aa361 - 375
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,577.8 g/molH-LVSSENFDDYMK^-OH
Peptide H-LVSSENFDDYMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WFSAGLASNSSWLR^-OH
<p>Peptide H-WFSAGLASNSSWLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGSEAYNQQLSEK^-OH
<p>Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Asp-Glu-Val-Asp-AMC ammonium salt
CAS:<p>Ac-Asp-Glu-Val-Asp-AMC ammonium salt is a small molecule that is used as a tool to study apoptosis in vitro. Ac-Asp-Glu-Val-Asp-AMC ammonium salt induces apoptosis by blocking the mitochondrial membrane potential and inducing the release of cytochrome c from mitochondria into the cytoplasm. This drug also induces activation of caspase 3, which initiates the cascade of events leading to cell death. Ac-Asp-Glu-Val-Asp-AMC ammonium salt has been shown to have an antiangiogenic effect on hl60 cells. This effect may be due to its ability to inhibit expression of survivin, a protein that protects cells from apoptosis. The efficacy of this drug in an experimental model has been shown to be dependent on toll like receptor (TLR) signaling pathways and mitochondrial function.br></p>Formula:C30H37N5O13•NH3Purity:Min. 97 Area-%Color and Shape:PowderMolecular weight:692.67 g/molH-TTPPVL^DSDGSF^FLYSR-OH
<p>Peptide H-TTPPVL^DSDGSF^FLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLRPGGKKK^-OH
<p>Peptide H-RLRPGGKKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PEG2000-DSPE-SLEEEWAQVECEVYGRGCPSGSLDESFYDWFERQLG-OH
<p>Peptide PEG2000-DSPE-SLEEEWAQVECEVYGRGCPSGSLDESFYDWFERQLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDNLAR^-OH
<p>Peptide H-ALDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDALNETR^-OH
Peptide H-EDALNETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENILGSYFDVK^-OH
<p>Peptide H-ENILGSYFDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-D^LDVPIPGRFDRRVSVAAE-OH
<p>Peptide H-D^LDVPIPGRFDRRVSVAAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPPSSGEPPK^-OH
<p>Peptide H-TPPSSGEPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYADSPSV^-OH
<p>Peptide H-SLYADSPSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAVYNLATC-OH
<p>Peptide H-KAVYNLATC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C43H69N11O12SColor and Shape:PowderMolecular weight:982.15 g/molCRF (human, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C208H344N60O63S2Molecular weight:4,758 g/molH-RV^YIHP-OH
Peptide H-RV^YIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLVDDFLL^V-OH
Peptide H-RLVDDFLL^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-HHHHHHHHHHHHHHHHHHHH-NH2
<p>Peptide Aoa-HHHHHHHHHHHHHHHHHHHH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SNKTRIDEANQRATKML-NH2
<p>Peptide Ac-SNKTRIDEANQRATKML-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 42 (GLAWTRQQNQWKEPD)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,857 g/molH-QVSDLISVLR^-OH
Peptide H-QVSDLISVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-RPRLSHKGPMP-OH
<p>Peptide pE-RPRLSHKGPMP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-YG-OH
<p>Peptide Fluor-YG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 94
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,519.8 g/molMelanocyte Associated Antigen gp 100 (17 - 25)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C38H70N10O11Molecular weight:843.04 g/molH-FIDK^VRF-NH2
<p>Peptide H-FIDK^VRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 69
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,794.2 g/molH2NCO-HAEGTFTSDVSSYLEGQ-NH2
<p>Peptide H2NCO-HAEGTFTSDVSSYLEGQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SKIGSTENLK^-OH
Peptide H-SKIGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IL^DTAGQEEY-OH
<p>Peptide H-IL^DTAGQEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSISIQTEEQIHGK^-OH
Peptide H-GSISIQTEEQIHGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fibromodulin F3 250-259 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GGGGG-Dabcyl
Peptide H-GGGGG-Dabcyl is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV Seq2 aa: 179-186
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C52H70N10O10Molecular weight:995.17 g/molH-EILDLAAATER^-OH
Peptide H-EILDLAAATER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLEWVGWINTYTGEPTYAADFK^-OH
<p>Peptide H-GLEWVGWINTYTGEPTYAADFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NDPTQQIPK^-OH
Peptide H-NDPTQQIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVGGQEHFAHLLILR^-OH
Peptide H-YVGGQEHFAHLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-SMFVYGGCQGNNNNFQSKANC-NH2
<p>Peptide LCBiot-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>pE-HWSYGLRPGC-NH2
<p>Peptide pE-HWSYGLRPGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFQLFGSPPGQ^R-OH
<p>Peptide H-SFQLFGSPPGQ^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 60 (SGKLFMHVTLGSDVE)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,619.9 g/molH-ISFNFFVTAPK^-OH
<p>Peptide H-ISFNFFVTAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVEGAGSIAAATGFVK^-OH
Peptide H-TVEGAGSIAAATGFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DHSAIPVINR^-OH
<p>Peptide H-DHSAIPVINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QEPEPPEPFEYIDD-NH2
<p>Peptide Ac-QEPEPPEPFEYIDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^PPGFSPF-OH
<p>Peptide H-R^PPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AKTVKFK-MAP4
<p>Peptide H-AKTVKFK-MAP4 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLTKILTI^-OH
<p>Peptide H-FLLTKILTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAIIK^-OH
Peptide H-NAIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.BBC3-related peptide amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-SYEL-OH
<p>Peptide Ac-SYEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GWIFGTTLDSK^-OH
<p>Peptide H-GWIFGTTLDSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGFEDGSVLK^-OH
<p>Peptide H-LGFEDGSVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLLALLPSL^-OH
<p>Peptide H-QLLALLPSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[Cys17] - β - Amyloid (1 - 17)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C93H135N29O30S1Molecular weight:2,171.5 g/mol(3S)-3-[[(2S)-2-[[(2S)-2-[[(1R,4S,7S,10S,13S,16S,19S,22S,25R,28S,31R,36R,39S,42S,45S)-31-amino-7,13-bis(4-aminobutyl)-22-benzyl-4-(2 -carboxyethyl)-10-(carboxymethyl)-19,28-bis[(1R)-1-hydroxyethyl]-16,39,42-tris[(4-hydroxyphenyl)methyl]-3,6,9,12,15,18,21,
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C121H168N26O33S4Molecular weight:2,643.1 g/molAc-WDWDWDWDWDWDWDWDWDWD-NH2
Peptide Ac-WDWDWDWDWDWDWDWDWDWD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISIDVNNNDIK^-OH
Peptide H-ISIDVNNNDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SLC6A14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A14 antibody, catalog no. 70R-6568Purity:Min. 95%H-LAV^YQAGAR-OH
Peptide H-LAV^YQAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 61 (FMHVTLGSDVEEDLT)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,692.9 g/molgp100 (86-95)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-PLGIEVDIDVEHGGKRC-NH2
<p>Peptide Ac-PLGIEVDIDVEHGGKRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 110 (RKSASSATACTSGVM)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,456.7 g/molHIV - 1 MN ENV - 10
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,727 g/molMeO-Suc-Arg-Pro-Tyr-pNA
<p>Peptide MeO-Suc-Arg-Pro-Tyr-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:668.71 g/molMyelin Basic Protein (111-129)
<p>The myelin sheath which is located in both the Central Nervous System (CNS) and the Peripheral Nervous System is crucial for neural insulation and the salutatory conduction of nerve impulses. When this myelin sheath is destroyed neurodegeneration and conduction failure occur and theses occurrences can be observed in demyelinating diseases in the CNS such as: acute disseminated encephalomyelitis and multiple sclerosis and within the PNS: Guillain–Barré syndrome and Charcot–Marie–Tooth disease.Myelin Basic Protein (MBP) from which this product is derived is the second most abundant protein in myelin. It has been found to be an intrinsically disordered protein and depending on the environmental conditions it can change its conformation. It also folds into ⍺-helical structures which allow MBP to bind tightly to lipid bilayer surfaces. MBP also interacts with other proteins, namely cytoskeletal proteins and calmodulin and may be involved in signalling pathways.<br>Although more research needs to be carried out, it is thought that MBP significantly contribute to the pathogenesis of multiple sclerosis. As MBP is an autoantigen it can be recognized and cleaved by autoantibodies and is a substrate for the immunoproteasome. Additional research has found that post-translational modifications of MBP such as the removal of arginine are increased and may be involved in the pathogenesis of multiple sclerosis. Therefore this protein derived from MBP can be used to mimic Neurodegenerative disease phenotypes in research and animal models.<br>One-Letter Formula: LSRFSWGAEGQRPGFGYGG</p>Formula:C92H129N27O26Purity:Min. 95%Molecular weight:2,029.22 g/molMAGE-9 (223-231)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:938.2 g/molH-NAVEVLKR^-OH
Peptide H-NAVEVLKR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKKPQITTEPHAT-OH
<p>Peptide Ac-CKKPQITTEPHAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Qpy-NH2
<p>Peptide Ac-Qpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Enterocin RJ-11
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-TVQIAAVVDVIR^-OH
<p>Peptide H-TVQIAAVVDVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myr-FTEIPTI-OH
Peptide Myr-FTEIPTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGKPAPDFK^-OH
<p>Peptide H-IGKPAPDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESTLGFVDLLR^-OH
<p>Peptide H-ESTLGFVDLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH
<p>Peptide H-ILMQYIKANSKFIGIPMGLPQSIALSSLMVAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGGFLRRIR^PKLK-OH
<p>Peptide H-YGGFLRRIR^PKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C192H295N61O60SMolecular weight:4,449.9 g/molH-RLVDDFLLV^-OH
<p>Peptide H-RLVDDFLLV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EPISVSSEQVLK^-OH
Peptide H-EPISVSSEQVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV-2 Nucleocapsid_3 B7 (HLA-B*07:02)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-LQAHLVAQTNLLR^-OH
<p>Peptide H-LQAHLVAQTNLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYGAEIVSALDYLHSEK^-OH
<p>Peptide H-FYGAEIVSALDYLHSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tyrosyl-prolyl-tryptophyl-threonine
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C29H35N5O7Molecular weight:565.6 g/molH-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Molecular weight:4,240.7 g/molH-LTVVILEAK^-OH
Peptide H-LTVVILEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DYVEINGEK^-OH
<p>Peptide H-DYVEINGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-γ-Abu-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-γ-Abu-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin used as a building block in peptide synthesis. The resin is composed of N-(2-chloroethyl)-N,N'-bis(2,3,5,6-tetrafluorohexyl)trimethoxysilane. Resins are inert and insoluble in organic solvents. They are very useful in peptide synthesis because they can be used to link amino acids together by forming amide bonds.</p>Purity:Min. 95%LCBiot-YGGFLRRI-OH
Peptide LCBiot-YGGFLRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-QEPEPPEPFEYIDD-NH2
<p>Peptide LCBiot-QEPEPPEPFEYIDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-Me-D-Glu-OH
CAS:<p>N-Me-D-Glu is an amino acid that is a substrate for the enzyme glutamate dehydrogenase. It is also a substrate for the enzyme N-acetylglutamate synthase and can be converted to glutamine. This amino acid has been extensively studied in relation to its conformational properties and its ability to form covalent adducts with amines. The type species of this amino acid is Saccharomyces cerevisiae, which contains an active glutamate dehydrogenase.</p>Formula:C6H11NO4Purity:Min. 95%Molecular weight:161.16 g/molH-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLLVP^TQFV-OH
<p>Peptide H-RLLVP^TQFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYSKPFHPK^-OH
<p>Peptide H-TYSKPFHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KRRR-NH2
<p>Peptide Ac-KRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HTSVQTTSSGSGPFTDVR^-OH
<p>Peptide H-HTSVQTTSSGSGPFTDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CONSENSUS B Tat - 6
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,755.2 g/molGonadoliberin-2 (Human, Chicken)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,236.33 g/molH-AVVEVDESGTR^-OH
<p>Peptide H-AVVEVDESGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Azido-GIGAVLKVLTTGLPALISWIKRKRQQ-OH
Peptide 5Azido-GIGAVLKVLTTGLPALISWIKRKRQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DI^TPTLTLYVGK^-OH
<p>Peptide H-DI^TPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVFVHPNYSK^-OH
<p>Peptide H-EVFVHPNYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bax H2 - H3 (53 - 86), Helix 2 - 3
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:3,797.3 g/mol10Panx
CAS:<p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C58H79N15O16Molecular weight:1,242.4 g/molH-DDSSPGFFLKITKNVPRL-NH2
<p>Peptide H-DDSSPGFFLKITKNVPRL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CFTR (108-117), Pseudomonas aeruginosa Inhibitor
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C51H77N15O22Molecular weight:1,252.27 g/molH-YHPNGMNPYTKA-NH2
<p>Peptide H-YHPNGMNPYTKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PSI
CAS:PSI is a proteasome inhibitor.Formula:C32H50N4O8Purity:97% - 98.33%Color and Shape:SolidMolecular weight:618.76CY5-SE triethylamine salt
CAS:CY5-SE triethylamine salt (Fluorolink Cy5 triethanolamine salt) is a hydrophilic amine-reactive fluorescent probe (Ex=649 nm; Em=670 nm).Formula:C43H58N4O10S2Purity:97.03% - 98.07%Color and Shape:SolidMolecular weight:855.07Boc-L-His(Tos)-OH
CAS:Controlled Product<p>Applications Boc-L-His(Tos)-OH, is an amino acid building block used in peptide synthesis. With a growing peptide drug market the fast, reliable synthesis of peptides is of great importance.<br></p>Formula:C18H23N3O6SColor and Shape:NeatMolecular weight:409.46Acetyl-L-phenylalanine Ethyl Ester
CAS:Controlled Product<p>Applications Acetyl-L-phenylalanine ethyl ester is a derivative of L-Phenylalanine (P319415), a nonpolar, essential amino acid that naturally occurs in the human body and is also used to treat patients with depression. Acetyl-L-phenylalanine ethyl ester is also used to inhibit pepsin-catalyzed reactions.<br>References Auer, H. & Doty, P.: Biochemistry, 5, 1708 (1966); Birkmayer, W., et al.: J. Neural Transm., 59, 81 (1984); Borison, R., et al.: Res. Commun. Chem. Path., 21, 363 (1978); Kitson, T., et al.: Biochem. J., 122, 241 (1971)<br></p>Formula:C13H17NO3Color and Shape:NeatMolecular weight:235.28Cyanoacetic Acid-13C2
CAS:Controlled Product<p>Applications Cyanoacetic Acid-13C2 is an intermediate for the synthesis of Diclazuril-13C3,15N2 (D436202), which is the labelled analogue of Diclazuril (D436200). Diclazuril is a nucleotide analogue with broad-spectrum anticoccidial activity and a coccidiostat.<br>References Maes, L., et al.: J. Parasitol., 74, 931 (1988)<br></p>Formula:C13C2H3NO2Color and Shape:NeatMolecular weight:87.05N-L-α-Glutamyl-L-glutamic Acid
CAS:Controlled ProductFormula:C10H16N2O7Color and Shape:NeatMolecular weight:276.24c-Myc tag Peptide
c-Myc Peptide displaces c-Myc-tagged proteins from antibodies, proving specific binding and regulating gene transcription.Formula:C51H86N12O21Purity:98%Color and Shape:SolidMolecular weight:1203.3H-KRSFIEDLLF-OH
Peptide H-KRSFIEDLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLHPLEGAVVIIFK-OH
Peptide H-VLHPLEGAVVIIFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALYLVCGER-OH
Peptide H-ALYLVCGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGDSPASSKP-OH
Peptide H-RGDSPASSKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C40H68N14O16Molecular weight:1,001.1 g/molH-YEVHHQKL-NH2
<p>Peptide H-YEVHHQKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQR-OH
Peptide H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DISEMFLQIYK-OH
Peptide H-DISEMFLQIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGVSNRDFV-OH
<p>Peptide H-IGVSNRDFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPTPNVSVVDLTCR-OH
<p>Peptide H-VPTPNVSVVDLTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLADLTLLDSPIK-OH
Peptide H-TLADLTLLDSPIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGESAEFVCK-OH
Peptide H-TGESAEFVCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TAATNAACA-OH
<p>Peptide H-TAATNAACA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-CCCC-OH
Peptide H-CCCC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C12H22N4O5S4Molecular weight:430.59 g/molH-Myr-GSNKSKPK-NH2
Peptide H-Myr-GSNKSKPK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIQLVEEELDR-OH
<p>Peptide H-GIQLVEEELDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSLARFRNI-OH
<p>Peptide H-GSLARFRNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLSLAQEQVGGSPEK-OH
Peptide H-VLSLAQEQVGGSPEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLLGLCEQK-OH
Peptide H-DLLGLCEQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPGAAGYDL-OH
Peptide H-SPGAAGYDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDTSCVNPPTVQNAHILSR-OH
Peptide H-STDTSCVNPPTVQNAHILSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITIRPR-OH
Peptide H-LSITIRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPQGFSAL-OH
<p>Peptide H-DLPQGFSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTKHLNQISQSY-OH
Peptide H-VTKHLNQISQSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR-OH
<p>Peptide H-ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VETPIRNEW-OH
<p>Peptide H-VETPIRNEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQEQVSPLTLLK-OH
<p>Peptide H-NQEQVSPLTLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GCRDVPMSMRGGDRCG-OH
Peptide H-GCRDVPMSMRGGDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QIFNKPYWL-OH
Peptide H-QIFNKPYWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HYNPSLK-OH
<p>Peptide H-HYNPSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
<p>Peptide H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C258H401N79O78Molecular weight:5,857.5 g/molH-TEGDGVYTLNDK-OH
<p>Peptide H-TEGDGVYTLNDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDELLQSQIEK-OH
Peptide H-LDELLQSQIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIYLNSGLTSTK-OH
<p>Peptide H-NIYLNSGLTSTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESDPIVAQY-OH
Peptide H-ESDPIVAQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVLDSGISEVR-OH
<p>Peptide H-TVLDSGISEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDFAVGEYNK-OH
<p>Peptide H-ALDFAVGEYNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNPESSFNDENLR-OH
Peptide H-GNPESSFNDENLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLGEENFK-OH
<p>Peptide H-DLGEENFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTHWFVTQR-OH
Peptide H-GTHWFVTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVEALYLVCG-OH
Peptide H-LVEALYLVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPGQGSPGGNR-OH
Peptide H-YPGQGSPGGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLSLTYDQK-OH
<p>Peptide H-LLSLTYDQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYPVLEEMF-OH
Peptide H-TYPVLEEMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSLQPLALEGSLQKR-OH
<p>Peptide H-GSLQPLALEGSLQKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLLVFGIDV-OH
Peptide H-MLLVFGIDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQVGQVELGGGPGAGSLQ-OH
<p>Peptide H-LQVGQVELGGGPGAGSLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QPRLTPPQPL-OH
Peptide H-QPRLTPPQPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALLESSLRQA-OH
<p>Peptide H-ALLESSLRQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QETVDCLK-OH
<p>Peptide H-QETVDCLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPQKRPSCI-OH
<p>Peptide H-RPQKRPSCI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTPVGR-OH
Peptide H-YTPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLDALDSIK-OH
<p>Peptide H-VLDALDSIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEVLTPLKWYQNM-OH
Peptide H-YEVLTPLKWYQNM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RMIAISAKV-OH
Peptide H-RMIAISAKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IHSMNSTIL-OH
<p>Peptide H-IHSMNSTIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLNSVSVPR-OH
Peptide H-NLNSVSVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPASELLKYLTT-OH
<p>Peptide H-RPASELLKYLTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>


