Peptides

<p>Ac-Leu-Glu-His-Asp-H (aldehyde) is a research tool that is used in the study of ion channels and receptor proteins. It can be used to activate a receptor or ligand, or to inhibit them. Ac-Leu-Glu-His-Asp-H (aldehyde) can also be used as an antibody to identify peptides and proteins. This product has high purity and is intended for use in pharmacology and life science research.</p>

Peptide H-FYGAEIVSALEYLHSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Boc-D-Phe-OH is an antimicrobial peptide that is a small molecule with a molecular weight of 254.8. It has been shown to have anti-tumor activity, and can be used as an alternative to conventional chemotherapeutic drugs in the treatment of cancer. Boc-D-Phe-OH binds to the hydrophobic region on the surface of cells and disrupts the cell's membrane, causing cell death by apoptosis. This peptide also shows antibacterial activity against gramicidin S, which is a Gram-positive antibiotic that belongs to the polymyxins class. The antibacterial activity of this peptide may be due to its ability to bind to divalent cations such as calcium ions and magnesium ions. Boc-D-Phe-OH has been synthesized using a method that is both efficient and rapid (less than 12 hours). It has also been shown that this peptide does not show any</p>

<p>Peptide Ac-RNQDQQGPFKMC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>

HRK-Y is a synthetic BH3 peptide that selectively antagonizes BCL-XL, a pro-survival protein of the Bcl-2 family. This interaction disrupts the balance of Bcl-2 family proteins, leading to cytochrome c release and subsequent apoptosis in susceptible cancer cells. HRK-Y is utilized in BH3 profiling assays to assess the sensitivity of cancer cells to BH3-mimetic drugs and to identify potential synergistic effects with NK cell-based therapies.

<p>Metastin is a peptide that activates the Kisspeptin receptor. It has been shown to inhibit protein interactions, activate ligands and receptors, and act as a research tool in cell biology. Metastin is an inhibitor of the G-protein coupled receptor, KISS1R. Metastin has been shown to activate the LGR5 receptor.</p>

<p>NPY is a peptide that belongs to the family of neuropeptides. NPY regulates appetite and energy expenditure, among other physiological processes, by binding to receptors in the brain. NPY has been shown to be an inhibitor of protein interactions, activator of ligands, and a receptor for antibodies. This peptide is synthesized in the hypothalamus as well as other parts of the central nervous system. NPY is also found in blood platelets, pancreas, and intestines.</p>

Peptide H-YTDV^SNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Ubenimex is a peptide-based inhibitor of aminopeptidase enzymes that act on the N-terminus of amino acid chains. It is also an inhibitor of Leucine aminopeptidase 3 (LAP3) and a potent irreversible inhibitor of Leukotriene A4 (LTA4) hydrolase. It is used in the treatment of non-alcoholic steatohepatitis. Ubenimex binds to the active site of aminopeptidases and inhibits their activity, thus preventing degradation of peptides. Ubenimex has been shown to inhibit aminopeptidase A and B, but not C or D. As a result, it prevents cleavage of the N-terminal amino acids from proteins, which may be involved in inflammatory processes. Furthermore Bestatin has been shown to exhibit antibacterial properties against P. gingivalis and F. nucleatum and is available in the salt form: Hydrochloride.</p>

<p>NPY is a neuropeptide that belongs to the peptide family of neuropeptides. NPY is an activator of G-protein coupled receptors, and it regulates a variety of physiological functions, such as feeding behavior, energy expenditure and water balance. NPY is also involved in various diseases, such as diabetes mellitus, hypertension and cardiac hypertrophy. NPY (Porcine) can be used as a research tool for studying the biological function of NPY or for ligand-binding assays.</p>

<p>Peptide Ac-TPSLPTPPTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Pramlintide is a synthetic analog for amylin pancreatic peptide that has been used for the treatment of Type I and Type II Diabetes as a tool for glycemic control, stimulating glucose production and reducing appetite. This product has disulfide bonds between Cys2 and Cys7 and is available in the trifluoroacetate salt form.

<p>Peptide LCBiot-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide Aoa-KRRGSTCVLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DLSLEEIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SIAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Ala-Tyr-Pro-Gly-Lys-Phe-NH2 is a selective inhibitor of aminopeptidase N. It has been shown to inhibit neutrophil and leukocyte recruitment in rat peritonitis models, as well as to reduce the severity of carrageenan induced paw edema in rats. H-Ala-Tyr-Pro-Gly-Lys-Phe NH2 also inhibits the activation of platelets by aspirin and reduces their aggregation, which may be due to inhibition of PAR4.<br>PAR4 is a G protein coupled receptor that is activated by proteases such as thrombin and trypsin. Activation of PAR4 induces proinflammatory cytokines, leading to increased leukocyte recruitment and inflammation.</p>

<p>Peptide H-EGYLQIGANTQAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Bz-Gly-Arg is a basic protein that belongs to the class of peptide hormones. It is activated by hydrolysis and has been shown to be highly active in human serum. Bz-Gly-Arg inhibits creatine kinase, which is an enzyme that breaks down ATP and creatine phosphate to produce creatinine and ADP. This inhibition leads to a decrease in ATP levels, which can lead to cell death. The kinetic properties of Bz-Gly-Arg have been studied using sephadex G-100 chromatography and found the optimum pH for this protein is neutral. The polymerase chain reaction has also been used to study the sequence of amino acids in this protein, showing it contains amide bonds as well as peptides and biochemicals.&gt;&gt;END&gt;&gt;</p>

<p>Fmoc-D-Arg(Pbf)-OH is a synthetic D-arginine peptide. It is an inhibitor of protein interactions, activator of ligand, and a research tool for receptor binding studies. Fmoc-D-Arg(Pbf)-OH has been used to characterize ion channels and antibody binding sites. This molecule has high purity with no impurities or traces of solvent.</p>

<p>PACAP38 is a ligand that belongs to the family of peptides. It binds to the PAC1 receptor and activates it. PACAP38 has been shown to inhibit ion channels, such as potassium channels and calcium channels, in neuronal cells. The protein interactions of PACAP38 are not yet fully understood.</p>

<p>Boc-Thr(Bzl)-OH is a peptide that can be used as an activator, inhibitor and ligand. It has been shown to activate ion channels and increase the permeability of cell membranes. The high purity of this peptide allows it to be used in research tools such as antibody production, protein interactions, and receptor ligand pharmacology.</p>

<p>Proangiotensin-12 is a peptide that is used as a research tool for the study of angiotensin II and its receptor. This product is an activator of the receptor and can be used to identify antibodies against the protein. Proangiotensin-12 has been shown to inhibit ion channels, and has also been shown to bind with high affinity to the angiotensin II receptor. This product can be used in pharmacological studies on ligands or receptors.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-FTISADTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EFTPPVQAAYQK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

The enzyme DNP-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser (DAPPLE) is a zymogen that is activated by proteolytic cleavage to form an active enzyme. DAPPLE has been shown to cause neuronal death in vitro. The enzyme can be inhibited by the addition of specific inhibitors, such as 4-(2-aminoethyl)benzenesulfonyl fluoride, which blocks the activity of matrix metalloproteinases. DAPPLE has been found in mammalian ovaries and induces the release of growth factors when it is activated by proteolytic cleavage. The optimum pH for DAPPLE activity is 7.5 and it can be inhibited by the addition of certain drugs, such as phenylmethylsulfonyl fluoride or sodium azide.

<p>EDDnp is a potent and selective inhibitor of the proteolytic enzyme dipeptidyl peptidase IV (DPP-IV). EDDnp binds to the active site of DPP-IV, which prevents it from cleaving peptides at the carboxy terminus. The inhibition of DPP-IV results in an increase of peptide hormones such as glucagon-like peptide 1 (GLP-1) and gastric inhibitory polypeptide (GIP), which are involved in regulating blood glucose levels. In addition, there are high values of EDDnp in human serum and urine, which may be due to its function as a potential biomarker for diabetes. The physiological function of EDDnp is still being investigated.</p>

<p>Peptide H-FNWY^VDGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EALDESIPPVSFWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-D-Ser(Bzl)-OH is a synthetic molecule that can be used in peptide synthesis. It is a potent inhibitor of galactose and tetrazole, and it inhibits the activities of enzymes involved in the synthesis of proteins, such as methionine synthase. Boc-D-Ser(Bzl)-OH has been shown to inhibit atherosclerotic lesions by blocking secretagogue activity and also inhibits the production of inflammatory mediators. This compound has potent inhibitory effects on piperidine.

<p>Lixisenatide is a peptide hormone that belongs to the class of dipeptidyl peptidase-4 inhibitors. It is used in the treatment of type 2 diabetes, including those with a body mass index (BMI) greater than 27 kg/m2 or who have had type 2 diabetes for more than 10 years. Lixisenatide reduces postprandial blood glucose levels by delaying gastric emptying and increasing glucagon-like peptide-1 (GLP-1) release. Lixisenatide has been shown to be effective in reducing cardiovascular events in people with congestive heart failure. Lixisenatide also has water vapor and cardiac effects that are similar to those of GLP-1 agonists.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc-Asp(OtBu)-OH is a chemical compound that belongs to the group of modified amino acids. The synthesis of Fmoc-Asp(OtBu)-OH starts with the reaction of nicotinic acetylcholine, sodium carbonate, and chloride in trifluoroacetic acid. The product is then reacted with a disulfide bond and modified with polymerase chain and saponified. The final modification is achieved by reacting Fmoc-Asp(OtBu)-OH with messenger RNA (mRNA), which produces the desired product. Fmoc-Asp(OtBu)-OH has been shown to have minimal activity, as it does not elute from an ion exchange column under normal conditions. It also has no effect on acetylcholine release in rat hippocampal slices or on morphology when incubated in vitro for 24 hours at 37 degrees Celsius.

<p>Fmoc-Arg(Pbf)-OH is an amido-resin that is used in the industrial preparation of polyamides and as a reactive component for the synthesis of various peptide or protein drugs. The polymerisation reaction leads to the formation of a linear chain with a high molecular weight and low viscosity. Fmoc-Arg(Pbf)-OH has been used as an envisaged component for the synthesis of acetylcholine, messenger RNA, and nicotinic acetylcholine receptor. Trifluoroacetic acid is commonly used as a solvent in this process.</p>

Fmoc-Ser(tBu)-Gly-OH is a building block for the synthesis of dipeptides. It contains a free amino group and can be used to synthesize peptides containing serine and glycine. This reagent can also be used in the synthesis of other dipeptides, such as Fmoc-Leu-OH, Fmoc-Phe-OH, and Fmoc-Ile-OH.

Peptide H-DESGLPQLTSYDAEVN^^APIQGSRNLLQGEELLRALDQVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Uroguanylin (Human) product containing the disulfide bonds: Cys4-Cys12 and Cys7-Cys15 and avaialable in the trifluoroacetate salt form. Uroguanylin is a peptide hormone that is involved in the regulation of fluid and electrolyte balance in the body. It is produced in the intestinal tract, specifically in the lining of the small intestine and colon.<br>Uroguanylin belongs to a family of peptides that includes guanylin and the heat-stable enterotoxins (STs).These peptides all share a similar structure and function, as they bind to and activate the guanylate cyclase-C (GC-C) receptor in intestinal cells.<br>Activation of GC-C by uroguanylin leads to an increase in cyclic GMP (cGMP) levels, which in turn activates a variety of downstream signaling pathways. This leads to an increase in chloride and bicarbonate secretion in the intestine, as well as an increase in intestinal fluid secretion. Uroguanylin also stimulates sodium and water reabsorption in the kidneys, leading to an increase in urine output.<br>Uroguanylin has been studied for its potential therapeutic applications, particularly in the treatment of gastrointestinal disorders. For example, synthetic analogs of uroguanylin are being developed as potential treatments for constipation and other disorders of intestinal motility. Additionally, uroguanylin has been shown to have anti-inflammatory properties and may be useful in the treatment of inflammatory bowel disease.</p>

Please enquire for more information about Fmoc-Glu(OtBu)-OH•H2O including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Boc-Arg(NO2)-OH is an activated molecule that is used as an anticoagulant. It inhibits the serine protease, which has an inhibitory effect on heparin-induced thrombocytopenia, and also inhibits platelet aggregation. Boc-Arg(NO2)-OH has been shown to have a potent inhibition of the enzyme that converts prothrombin into thrombin. This effect can be reversed by adding protamine sulfate. The clinical data suggest that this drug may be beneficial for patients with severe or life-threatening conditions who are taking heparin therapy or undergoing surgery and need anticoagulation. The prognosis of this drug is unclear, but it appears to be safe when administered in conjunction with other medications such as aspirin and warfarin.</p>

<p>inhibitor of chymotrypsin-like activity of the multicatalytic proteinase complex in HT4 cells.  Causes accumulation of ubiquitinylated proteins in neuronal cells.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

<p>This is a synthetic peptide that mimics the endogenous human epidermal growth factor (EGF) and binds to the toll-like receptor. It has been shown to stimulate physiological function in experimental models of bowel disease and cardiac disease, as well as cancer tissues. The peptide also binds to the guanine nucleotide-binding protein, polymerase chain reaction, and inflammatory bowel disease genes. In vivo studies have confirmed that this peptide enhances the production of EGF in maternal blood and stimulates squamous carcinoma growth in an animal model.</p>