Peptides
Subcategories of "Peptides"
Found 29900 products of "Peptides"
MBP (74-85), guinea pig
Catalogue peptide; min. 95% purity
Formula:C56H94N20O23Molecular weight:1,415.49 g/molVal-Asp-(Arg8)-Vasopressin
Catalogue peptide; min. 95% purity
Formula:C55H79N17O16S2Molecular weight:1,298.48 g/molBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C157H252N46O44S2Molecular weight:3,552.17 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Formula:C65H109N17O19SMolecular weight:1,464.75 g/molAc-[Nle4,DPhe7] a-MSH (4-10), amide
Catalogue peptide; min. 95% purityFormula:C47H64N14O10Molecular weight:985.12 g/molConantokin T, Marine snail, Conus tullpa
Catalogue peptide; min. 95% purityFormula:C110H175N31O45SMolecular weight:2,683.81 g/molZ-Ile-His-OH
CAS:Please enquire for more information about Z-Ile-His-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H26N4O5Purity:Min. 95%Molecular weight:402.44 g/molTrt-Glu(OtBu)-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Trt-Glu(OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C28H31NO4·C12H23NPurity:Min. 95%Molecular weight:626.87 g/molH-Ala-Ala-Ala-OH
CAS:H-Ala-Ala-Ala-OH is a synthetic peptide that has been shown to inhibit protease activity and is being investigated as a potential treatment for chronic arthritis. This peptide has been shown to be effective in the removal of nitrogen from wastewater. The conformational properties of H-Ala-Ala-Ala-OH are similar to those of the human serum amide, which is thought to have an antiarthritic effect and may also act as a model system for other peptides. H-Ala-Ala-Ala-OH has also been shown to have enzyme activities, including dihedral and structural analysis.
Formula:C9H17N3O4Purity:Min. 95%Molecular weight:231.25 g/mol[Pyr16]-VIP (16-28) (chicken)
Catalogue peptide; min. 95% purityFormula:C67H113N17O18SMolecular weight:1,476.83 g/molACTH(4-9), Tyr
Catalogue peptide; min. 95% purity
Formula:C53H68N14O12SMolecular weight:1,125.28 g/mol(Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri
CAS:Please enquire for more information about (Phenylac 1,D-Tyr(Me)2,Arg6·8,Tyr-NH29)-Vasopressin trifluoroacetate salt Phenylac-D-Tyr(Me)-Phe-Gln-Asn-Arg-Pro-Arg-Tyr-NH2 tri including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C62H83N17O13Purity:Min. 95%Color and Shape:PowderMolecular weight:1,274.43 g/molMC-Gly-Gly-Phe-Gly-NH-CH2-O-CH2COOH
CAS:This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.
Formula:C28H36N6O10Purity:Min. 95%Molecular weight:616.6 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Fmoc-Leu-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Leu-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Boc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formula:C23H28F3N3O6Purity:Min. 95%Molecular weight:499.48 g/molRenoguanylin (eel)
Catalogue peptide; min. 95% purity
Formula:C66H102N16O22S4Molecular weight:1,599.90 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Molecular weight:1,009.19 g/molTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C80H137N19O25Purity:Min. 95%Molecular weight:1,765.06 g/molFluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C43H45FN4O16Purity:Min. 95%Molecular weight:892.83 g/molGRF (human) acetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molPancreatic Polypeptide (31-36) (free acid) (human)
Catalogue peptide; min. 95% purityFormula:C36H60N12O9Molecular weight:805 g/molH-Gly-Asp-Asp-Asp-Asp-Lys-bNA trifluoroacetic acid
CAS:H-Gly-Asp-Asp-Asp-Asp-Lys-bNA trifluoroacetic acid is a peptide that is used as a biocatalyst in the production of microspheres. It is also known as enterokinase, and cleaves proteins at their N termini. This enzyme has been immobilized on silica gel and then applied to the production of microspheres. The half life of this enzyme is 1 hour at 37°C, but it can be increased to 8 hours by immobilizing it on silica gel using glutaraldehyde. HGAASDAAKLysBNAtrifluoroacetic acid has been shown to have a high specific activity with an efficiency of 60% and a pH range between 4 and 10. It has been shown to have high protein cleavage rates at 30°C, 37°C, and 40°C, with bovine serum albumin being the
Formula:C38H45N8O16F3Purity:Min. 95%Molecular weight:788.76 g/mol[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat
Catalogue peptide; min. 95% purityFormula:C116H185N31O29SMolecular weight:2,510 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C49H68N14O15Purity:Min. 95%Molecular weight:1,093.15 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Molecular weight:2,930.38 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS:Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C35H40N4O7Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:628.71 g/molbeta-Amyloid (22-35)
Catalogue peptide; min. 95% purityFormula:C59H102N16O21SMolecular weight:1,403.63 g/mol[Ala3,11,18, Nle7] Endothelin-1, human
Catalogue peptide; min. 95% purityFormula:C109H161N25O29S2Molecular weight:2,349.78 g/molAquaporin-2 (254-267), human
Catalogue peptide; min. 95% purityFormula:C69H116N24O22Molecular weight:1,633.84 g/mol[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
Catalogue peptide; min. 95% purityFormula:C102H152N26O29Molecular weight:2,206.51 g/mol[D-Trp2,7,9]-Substance P
Catalogue peptide; min. 95% purityFormula:C80H109N21O13SMolecular weight:1,604.96 g/mol[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)
Catalogue peptide; min. 95% purityFormula:C44H64N14O10S2Molecular weight:1,013.22 g/molCalmodulin-Dependent Protein Kinase II (281-309)
Catalogue peptide; min. 95% purityFormula:C146H254N46O39S3Molecular weight:3,374.05 g/mol[Lys8,Asn9] Neurotensin LANT-6 (8-13)
Catalogue peptide; min. 95% purity
Formula:C36H58N8O9Molecular weight:746.91 g/molSomatostatin-14 (3-14)
Catalogue peptide; min. 95% purityFormula:C71H96N16O17S2Molecular weight:1,509.78 g/molα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Formula:C44H67N13O9Molecular weight:922.11 g/molDynorphin (2-17), amide, porcine
Catalogue peptide; min. 95% purityFormula:C90H147N31O20Molecular weight:1,983.37 g/mol[D-Ala2]-beta-Casomorphin (1-6), bovine
Catalogue peptide; min. 95% purityFormula:C33H42N6O8Molecular weight:650.7 g/molGlycoprotein Hormone a (32-46) amide
Catalogue peptide; min. 95% purity
Formula:C78H128N24O20SMolecular weight:1,754.09 g/molCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
Catalogue peptide; min. 95% purity
Formula:C47H85N14O13SMolecular weight:1,087.35 g/mol[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog
Catalogue peptide; min. 95% purity
Formula:C74H121N23O20Molecular weight:1,652.93 g/molGlucagon-Like Peptide 1, (GLP-1) amide, human
Catalogue peptide; min. 95% purityFormula:C184H273N51O57Molecular weight:4,111.53 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.Formula:C32H49N5O7•C2H4O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:675.81 g/molIntermedin (human)
Catalogue peptide; min. 95% purity
Formula:C219H351N69O66S3Molecular weight:5,102.84 g/mol
![Ac-[Nle4,DPhe7] a-MSH (4-10), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00019.webp&w=3840&q=75)
![[Pyr16]-VIP (16-28) (chicken)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00193.webp&w=3840&q=75)
![[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00400.webp&w=3840&q=75)
![[Ala3,11,18, Nle7] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00286.webp&w=3840&q=75)
![[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00427.webp&w=3840&q=75)
![[D-Trp2,7,9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00654.webp&w=3840&q=75)
![[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00137.webp&w=3840&q=75)
![[Phe2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00173.webp&w=3840&q=75)
![[Lys8,Asn9] Neurotensin LANT-6 (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00542.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-6), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00830.webp&w=3840&q=75)
![[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00527.webp&w=3840&q=75)
