Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30318 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Nps-Val-OH·DCHA
CAS:Controlled Product<p>Please enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N2O4S·C12H23NPurity:Min. 95%Molecular weight:451.62 g/molbeta-Defensin-3, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C216H371N75O59S6Molecular weight:5,155.22 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H54N8O10Molecular weight:782.90 g/molZ-Ile-Val-OH
CAS:<p>Please enquire for more information about Z-Ile-Val-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H28N2O5Purity:Min. 95%Molecular weight:364.44 g/molbeta-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formula:C145H209N41O46Molecular weight:3,262.53 g/molZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>Formula:C32H50N4O8Purity:Min. 95%Molecular weight:618.76 g/molH-Trp-Trp-OH
CAS:H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.Formula:C22H22N4O3Purity:Min. 95%Molecular weight:390.44 g/molZ-Gly-Val-OH
CAS:<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>Formula:C15H20N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:308.33 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/molFmoc-Lys(Nde)-OH
CAS:<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H29N3O8Purity:Min. 95%Molecular weight:583.59 g/molbeta-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H126N24O21S2Molecular weight:1,896.22 g/molH-D-Ala-Gln-octadecyl ester·HCl
CAS:<p>Please enquire for more information about H-D-Ala-Gln-octadecyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H51N3O4·HClPurity:Min. 95%Molecular weight:506.16 g/molOmega-Conotoxin MVIIC
CAS:Controlled Product<p>Omega-Conotoxin MVIIC is a peptide toxin that blocks the voltage-dependent calcium channels. It has been shown to have neuroprotective properties and to inhibit glutamate induced neurotoxicity in vitro and in vivo. Omega-Conotoxin MVIIC inhibits neurotransmitter release by blocking the calcium channels and thereby reduces oxidative stress, which prevents neuronal cell death. This toxin also blocks the activity of voltage-dependent sodium channels, but its effects are not as potent as those on calcium channels. Omega-Conotoxin MVIIC has been found to be effective against cerebellar granule neurons, as well as other neurons in the brainstem, cerebellum, hippocampus, and cerebral cortex. The molecular weight of this toxin is approximately 10 kDa and it contains subunits (a total of eight).</p>Formula:C106H178N40O32S7Purity:Min. 95%Color and Shape:PowderMolecular weight:2,749.26 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H28N2O7SPurity:Min. 95%Molecular weight:548.61 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C219H365N73O66SMolecular weight:5,108.86 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H108N22O16Molecular weight:1,453.72 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C205H340N60O53Molecular weight:4,493.37 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H71N13O15Molecular weight:1,070.18 g/molbeta II probe
<p>Catalogue peptide; min. 95% purity</p>Formula:C94H150N26O31SMolecular weight:2,172.46 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H71N13O14S2Molecular weight:1,046.24 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C104H159N29O31Molecular weight:2,311.60 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H137N25O35Molecular weight:2,045.16 g/molMMP-8 Substrate, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H63N13O13Molecular weight:1,042.14 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C56H80N12O14Molecular weight:1,145.3 g/molbeta-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C23H28N4O4Molecular weight:424.50 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H43N7O6SMolecular weight:701.85 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C197H317N59O54S3Molecular weight:4,472.26 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H91N17O15Molecular weight:1,254.47 g/molHIV-gp41-Antigenic Peptide 5
<p>Catalogue peptide; min. 95% purity</p>Formula:C184H282N56O53S2Molecular weight:4,190.77 g/molTNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C110H172N24O30Molecular weight:2,310.74 g/molbeta-Endorphin (27-31) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H45N7O9Molecular weight:623.71 g/molNTB (Naltriben)
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H65N11O11S2Molecular weight:1,060.29 g/molbeta-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Formula:C25H47N5O6SMolecular weight:545.75 g/mol[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)
<p>Catalogue peptide; min. 95% purity</p>Molecular weight:1,049.3 g/molLeucokinin V
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H46N10O11Molecular weight:782.8 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H73N13O10Molecular weight:980.20 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H123N27O27S5Molecular weight:2,091.39 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formula:C22H36N8O11Molecular weight:588.58 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H81N21O17Molecular weight:1,236.32 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H86N13O22PMolecular weight:1,300.36 g/molRS domain derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H85N25O15Molecular weight:1,204.33 g/molα-Casein (90-95)
<p>Catalogue peptide; min. 95% purity</p>Formula:C103H175N35O27SMolecular weight:2,367.83 g/molHPV-E6-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C76H128N24O25SMolecular weight:1,810.07 g/molSynapsin I-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H91N21O14Molecular weight:1,246.45 g/molHIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Formula:C116H164N32O31SMolecular weight:2,534.86 g/molGastric Inhibitory Polypeptide (1-30) (porcine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C162H244N40O48SMolecular weight:3,551.97 g/mol[D-Phe7] a-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C77H109N21O19SMolecular weight:1,664.92 g/molBiotin-Gastrin (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formula:C107H140N22O34S2Molecular weight:2,342.56 g/mol
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
![[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00141.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
