GPCR/G-Protéine
Les inhibiteurs des GPCR/protéines G sont des composés qui ciblent les récepteurs couplés aux protéines G (GPCR) et les protéines G associées, qui jouent un rôle crucial dans la transmission des signaux de l'extérieur vers l'intérieur des cellules. Ces inhibiteurs sont essentiels pour étudier les voies de signalisation médiées par les GPCR, impliquées dans de nombreux processus physiologiques, y compris la perception sensorielle, la réponse immunitaire et la neurotransmission. Les inhibiteurs des GPCR sont également importants dans le développement de médicaments, car de nombreux agents thérapeutiques ciblent ces récepteurs. Chez CymitQuimica, nous offrons une large gamme d'inhibiteurs de GPCR/protéines G de haute qualité pour soutenir vos recherches en pharmacologie, biologie cellulaire et domaines connexes.
Sous-catégories appartenant à la catégorie "GPCR/G-Protéine"
- récepteur 5-HT(1.025 produits)
- Récepteur d'adénosine(249 produits)
- Récepteur adrénergique(3.023 produits)
- Récepteur de la bombésine(35 produits)
- Récepteur de la bradykinine(61 produits)
- CXCR(158 produits)
- CaSR(34 produits)
- Récepteur cannabinoïde(217 produits)
- Cholécystokinine(1 produits)
- Récepteur de la dopamine(445 produits)
- Récepteur de l'endothéline(86 produits)
- Récepteur GNRH(84 produits)
- GPCR19(33 produits)
- GRK(33 produits)
- GTPase(23 produits)
- Récepteur du glucagon(194 produits)
- Hérisson/Smoothened(49 produits)
- Récepteur de l'histamine(385 produits)
- Récepteur LPA(21 produits)
- Récepteur de la mélatonine(26 produits)
- Récepteur OX(41 produits)
- Récepteur opioïde(327 produits)
- PAFR(14 produits)
- PKA(60 produits)
- Récepteur S1P(18 produits)
- SGLT(31 produits)
- Récepteur Sigma(46 produits)
Affichez 19 plus de sous-catégories
5986 produits trouvés pour "GPCR/G-Protéine"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Cannabigerorcin
CAS :Cannabigerorcin, a phytocannabinoid, serves as an analytical reference standard. It is designated for research and forensic applications.Formule :C17H24O2Couleur et forme :SolidMasse moléculaire :260.377LP 12 hydrochloride
CAS :LP 12 hydrochloride is a selective 5-HT7 receptor agonist (Ki=0.13 nM).Formule :C32H40ClN3OCouleur et forme :SolidMasse moléculaire :518.14Ethoxyquin Dimer
CAS :Ethoxyquin dimer is an antioxidant, metabolite of ethoxyquin, that protects fish meal/oil fats but can cause liver damage in mice.Formule :C28H36N2O2Couleur et forme :SolidMasse moléculaire :432.608(±)5-iPF2α-VI
CAS :Isoprostanes are prostaglandin (PG)-like products of free-radical induced lipid peroxidation.Formule :C20H34O5Couleur et forme :SolidMasse moléculaire :354.487Calcitonin (8-32), salmon
CAS :Calcitonin (8-32), salmon: selective amylin receptor antagonist, regulates calcium/phosphorus, thyroid origin, 32-aa peptide.Formule :C119H198N36O37Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2725.06Adrenomedullin (AM) (22-52), human TFA
Adrenomedullin (AM) human (22-52) is a truncated NH2 TFA-modified adrenal medullary receptor antagonist.Formule :C161H253N46F3O50Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3690.06Urocortin II, human acetate
Urocortin II, human acetate, is a selective endogenous peptide agonist of type 2 corticotropin-releasing factor (CRF2) receptors, used to study the role of CRF2 receptors in feeding behavior.Couleur et forme :Odour Solid4-Butyl-α-agarofuran
CAS :4-Butyl-alpha-agarofuran, a Gharu-wood derivative, is an anxiolytic, antidepressant, and aids neurological research.Formule :C18H30OCouleur et forme :SolidMasse moléculaire :262.43Tocrifluor T1117
CAS :Fluorescent form of AM 251, CB1 receptor antagonistFormule :C56H53Cl2N7O5Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :974.97mPGES-1/sEH-IN-1
mPGES-1/sEH-IN-1 (compound 1f) is an sEH inhibitor with an IC50 value of 5 μM. It also exhibits antitumor activity by inhibiting mPGES-1, with an IC50 value of 25 µM.Formule :C20H16F3N3O2Couleur et forme :SolidMasse moléculaire :387.355L-703606 oxalate hydrate
L-703606 oxalate hydrate is an effective, selective NK1 receptor antagonist. It is utilized in research related to gastric acid secretion.Couleur et forme :Odour SolidCinnamtannin A2
CAS :Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.
Formule :C60H50O24Couleur et forme :SolidMasse moléculaire :1155.02Cabergoline
CAS :Cabergoline (FCE-21336), an ergot-derived dopamine D2-like agonist, targets D2/D3/5-HT2B, normalizes prolactin, controls pituitary tumors.Formule :C26H37N5O2Degré de pureté :97.69% - 99.86%Couleur et forme :White Crystalline SolidMasse moléculaire :451.6CB2R probe 1
CAS :CB2R Probe 1, a cannabinoid 2 receptor (CB2R) fluorescent probe, exhibits both safety and environmental friendliness, boasting a dissociation constant (K i) of
Formule :C36H42N4O4Couleur et forme :SolidMasse moléculaire :594.74PACAP (6-38), human, ovine, rat acetate
PACAP (6-38), human, ovine, rat acetate is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptorFormule :C184H303N55O48SDegré de pureté :99.84%Couleur et forme :SoildMasse moléculaire :4085.84MI 1544
CAS :MI 1544 is a LHRH antagonist.Formule :C71H94ClN17O13Couleur et forme :SolidMasse moléculaire :1429.09Prostaglandin F2α Alcohol
CAS :Prostaglandin F2α Alcohol is a PGF2α (T15133) analogue. Prostaglandin F2α Alcohol is an orally active prostaglandin F receptor (FP receptor) agonist.Formule :C20H36O4Couleur et forme :SolidMasse moléculaire :340.5Semaglutide TFA
Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patientsFormule :C189H290F3N45O61Degré de pureté :99.69% - 99.94%Couleur et forme :SolidMasse moléculaire :4225.64829-deoxy-9-methylene-16,16-dimethyl Prostaglandin E2
CAS :Meteneprost is a strong, long-lasting Prostaglandin E2 analog effective in ending early monkey pregnancies without causing fever or GI issues.Formule :C23H38O4Couleur et forme :SolidMasse moléculaire :378.553SAE-14
CAS :GPR183, a chemotactic receptor aiding B cell maturation, binds 7α,25-OHC; studied in IBD research.Formule :C19H19F3N2O2Degré de pureté :99.85%Couleur et forme :SolidMasse moléculaire :364.36Tiaprost
CAS :Tiaprost is a analog of prostaglandin F2α .Formule :C20H28O6SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :396.5GLP-1R agonist 14
CAS :GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].Formule :C45H42F2N10O5Couleur et forme :SolidMasse moléculaire :840.88WB4-24
CAS :WB4-24 is a GLP-1 receptor agonist that enhances the release of β-endorphin in microglia. It exhibits antiallodynic, anti-inflammatory, and analgesic effects in mouse models of inflammation induced by formalin, carrageenan, and CFA.Formule :C52H48N4O14S2Couleur et forme :SolidMasse moléculaire :1017.09Luprostiol
CAS :Luprostiol is a prostaglandin analog.Formule :C21H29ClO6SCouleur et forme :SolidMasse moléculaire :444.97Conopeptide rho-TIA
CAS :Conopeptide rho-TIA, a peptide from Conus tulipa venom, acts as a selective, noncompetitive inhibitor at the human α1B-Adrenergic Receptor and as a competitiveFormule :C105H160N36O21S4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2390.88Atrial natriuretic peptide (3-28) (human)
CAS :Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)), a peptide hormone produced by the atrial myocardium, plays a critical role in the regulation ofFormule :C118H187N43O36S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2880.21Brexpiprazole S-oxide
CAS :Brexpiprazole S-oxide is the main metabolite of Brexpiprazole, a human 5-HT1A and dopamine receptor partial agonist (Ki: 0.12, 0.3 nM).Formule :C25H27N3O3SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :449.574-Methylhistamine
CAS :4-Methylhistamine serves as a potent agonist for the histamine 4 receptor (H4R), holding promise for research into immune-related diseases, including cancer andFormule :C6H11N3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :125.17Palonosetron N-oxide
CAS :Palonosetron N-oxide: metabolite and potential impurity of 5-HT3 antagonist palonosetron; forms under oxidative stress.Formule :C19H24N2O2Couleur et forme :SolidMasse moléculaire :312.413Cannabinol methyl ether
CAS :Cannabinol methyl ether, a phytocannabinoid, serves as an analytical reference standard. This compound can be obtained through isolation from Cannabis plants, derived from cannabinol, or synthesized. The physiological and toxicological properties of cannabinol methyl ether remain unknown. It is designed exclusively for research and forensic applications.Formule :C22H28O2Couleur et forme :SolidMasse moléculaire :324.5Cholecystokinin Octapeptide, desulfated TFA
CAS :Cholecystokinin Octapeptide, desulfated TFA, is a synthetic octapeptide derived from Cholecystokinin (CCK) that has undergone desulfation.Formule :C51H63F3N10O15S2Couleur et forme :SolidMasse moléculaire :1177.24Amylin, amide, rat
CAS :Amylin: peptide, 50% similar to CGRP, found with somatostatin in stomach cells, reduces acid secretion in mice.Formule :C167H272N52O53S2Degré de pureté :99.92%Couleur et forme :SolidMasse moléculaire :3920.442-Methyl-N,N-dimethyltryptamine
CAS :2-Methyl-N,N-dimethyltryptamine (2,N,N-TMT, compound 15) exhibits binding affinity for the serotonin (5-HT) receptor, with a pA2 value of 6.04. It plays a significant role in neurological disease research.Formule :C13H18N2Couleur et forme :SolidMasse moléculaire :202.3ACTH (7-38) (human)
CAS :ACTH (7-38) (human) is a fragment (7-38) of the full human adrenocorticotropic hormone (ACTH (1-39)), also referred to as corticotropin inhibitory peptide (CIPFormule :C167H257N47O46Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :3659.11NXT-10796
NXT-10796 is an orally active, intestinally restricted agonist of the EP4 receptor [1].Formule :C23H31N3O6Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :445.51PAR650097
PAR650097 is a humanized monoclonal antibody targeting PAR2, used in migraine research.Degré de pureté :96.67% (SEC-HPLC) - 98.83% (SEC-HPLC)Couleur et forme :LiquidMasse moléculaire :144.1 kDaJPC0323
JPC0323 is a dual positive allosteric modulator of the 5-HT2C and 5-HT2A receptors, featuring on-target properties, acceptable plasma exposure, and adequateFormule :C22H43NO4Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :385.58[Leu13]-Motilin
CAS :[Leu13]-Motilin (KW-5139) is an analogue of the gastrointestinal hormone motilin that induces concentration-dependent contractions in rabbit gastrointestinalFormule :C121H190N34O35Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :2681.01GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Couleur et forme :SolidMasse moléculaire :3850.31Cholecystokinin (27-32)-amide
CAS :Cholecystokinin (27-32)-amide is a CCK receptor antagonist.Formule :C36H48N8O12S3Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :881.01ELA-11(human)
CAS :Apelin receptor agonist with high affinity (Ki = 14 nM). Blocks cAMP production and promotes β-arrestin activation; derived from ELA-32.Formule :C58H90N16O13S2Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1283.57Phoenixin-14
CAS :Phoenixin-14 (PNX-14), an active endogenous isoform, induces an anxiolytic effect by activating the AHA GnRH system in mice and protects against ischemia/
Formule :C75H110N18O20Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :1583.78PZ-1922
PZ-1922 (Compound 16), able to cross the blood-brain barrier, is a dual antagonist for 5-HT6R and 5-HT3R with K i values of 17 nM and 0.45 nM, respectively.Degré de pureté :98%Couleur et forme :Odour SolidAB21 oxalate
AB21 oxalate, a potent and selective S1R antagonist, exhibits binding affinities (Kis) of 13 nM and 102 nM for S1R and S2R, respectively.Formule :C25H30N2O5Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :438.52Muscarinic toxin 3
CAS :Muscarinic toxin 3 (MT3), a potent non-competitive antagonist of mAChR and adrenoceptors, exhibits pIC50 values of 6.71 for M1, 8.79 for M4, 8.86 for α1A, 7.57Formule :C319H489N89O97S8Degré de pureté :98%Couleur et forme :SolidMasse moléculaire :7379.355-HT6 agonist 1
Compound 19, a 5-HT6 agonist with an affinity (K i : 5 nM), exhibits antidepressant-like effects and enhances cognitive function while also inhibiting plateletFormule :C17H22Cl2N6SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :413.37α-CGRP (mouse, rat) TFA
α-CGRP (mouse, rat) TFA, a neuropeptide belonging to the calcitonin gene-related peptide (CGRP) family, is predominantly located at neuromuscular junctions andFormule :C162H262N50O52S2·C2HF3O2Degré de pureté :98%Couleur et forme :SolidTriazolomethylindole-3-acetic acid
CAS :Triazolomethylindole-3-acetic acid is a metabolite of Rizatriptan, which acts as an agonist for the serotonin (5-HT) receptor subtypes 5-HT1B and 5-HT1D.Formule :C13H12N4O2Couleur et forme :SolidMasse moléculaire :256.26PSB-1114 triethylamine
PSB-1114 triethylamine is a potent, enzymatically stable, P2Y2 receptor agonist with a 134 nM EC50, exhibiting greater than 50-fold selectivity over P2Y4 (EC50Formule :C10H15F2N3O13P3S·xC6H15NDegré de pureté :98%Couleur et forme :Solidhuman GALP (3-32)
Human GALP (3-32) (Galanin-like peptide (3-32)) serves as a high-affinity agonist for galanin receptors GalR1 (IC50 = 33 nM) and GalR2 (IC50 = 15 nM), asFormule :C137H213N43O38SDegré de pureté :98%Couleur et forme :SolidMasse moléculaire :3102.49
![[Leu13]-Motilin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT78563.webp&w=3840&q=75)
