Proteina G/GPCR
Gli inibitori dei GPCR/proteine G sono composti che bersagliano i recettori accoppiati alle proteine G (GPCR) e le proteine G associate, che svolgono ruoli critici nella trasmissione dei segnali dall'esterno all'interno delle cellule. Questi inibitori sono essenziali per studiare le vie di segnalazione mediate dai GPCR, coinvolte in numerosi processi fisiologici, tra cui la percezione sensoriale, la risposta immunitaria e la neurotrasmissione. Gli inibitori dei GPCR sono anche importanti nello sviluppo di farmaci, poiché molti agenti terapeutici prendono di mira questi recettori. Presso CymitQuimica, offriamo una vasta gamma di inibitori dei GPCR/proteine G di alta qualità per supportare le tue ricerche in farmacologia, biologia cellulare e campi correlati.
Sottocategorie di "Proteina G/GPCR"
- recettore 5-HT(942 prodotti)
- Recettore dell'adenosina(242 prodotti)
- Recettore adrenergico(2.949 prodotti)
- Recettore della bombesina(30 prodotti)
- Recettore della bradichinina(59 prodotti)
- CXCR(149 prodotti)
- CaSR(32 prodotti)
- Recettore dei cannabinoidi(195 prodotti)
- Recettore della dopamina(410 prodotti)
- Recettore dell'endotelina(75 prodotti)
- Recettore GNRH(73 prodotti)
- GPCR19(31 prodotti)
- GRK(32 prodotti)
- GTPase(21 prodotti)
- Recettore del glucagone(166 prodotti)
- Proteina Hedgehog/Smoothened(45 prodotti)
- Recettore dell'istamina(359 prodotti)
- Recettore LPA(21 prodotti)
- Recettore della melatonina(24 prodotti)
- Recettore OX(40 prodotti)
- Recettore degli oppioidi(298 prodotti)
- PAFR(11 prodotti)
- PKA(49 prodotti)
- Recettore S1P(17 prodotti)
- SGLT(30 prodotti)
- Recettore Sigma(46 prodotti)
Mostrare 18 più sottocategorie
Trovati 5378 prodotti di "Proteina G/GPCR"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Apelin-36(rat, mouse)
CAS:Endogenous APJ agonist from adipocytes; binds APJ tightly, inhibits cAMP, regulates heart function and fluid balance, blocks some HIV strains.Formula:C185H304N68O43SPurezza:98%Colore e forma:SolidPeso molecolare:4200.93ELA-11(human) TFA
<p>ELA-11(human) TFA: apelin receptor agonist, K i =14 nM, inhibits cAMP, stimulates β-arrestin, from ELA-32 fragment.</p>Formula:C60H91F3N16O15S2Colore e forma:SolidPeso molecolare:1397.58PY-60
CAS:<p>PY-60 can effectively activate YAP transcriptional activity against annexin A2 (ANXA2).Cost-effective and quality-assured.</p>Formula:C16H15N3O2SPurezza:99.5% - 99.67%Colore e forma:SolidPeso molecolare:313.37Eletriptan
CAS:<p>Eletriptan, second-generation triptans used to treat migraines, is used as an abortion drug.</p>Formula:C22H26N2O2SColore e forma:SolidPeso molecolare:382.52P2Y6R antagonist 1
<p>P2Y6R antagonist 1 (compound 5ab) is a selective, orally active antagonist of P2Y6R, featuring an IC50 value of 19.6 nM. This compound also exhibits anti-inflammatory properties.</p>Colore e forma:Odour SolidBiotin-NeurokininA
<p>Biotin-NeurokininA: biotinylated peptide, NK-2 receptor agonist, key in human airway and gut function.</p>Formula:C60H94N16O16S2Colore e forma:SolidPeso molecolare:1359.61(Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin
CAS:<p>Potent VP V1R antagonist, lowers rat MAP: '(Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin'.</p>Formula:C54H76N14O11Colore e forma:SolidPeso molecolare:1097.27Peptide YY (pig)
CAS:<p>Peptide YY (pig), a 36 amino acid gut peptide from porcine duodenum, reduces appetite via Y2 receptor, affecting digestion and the heart.</p>Formula:C190H288N54O57Colore e forma:SolidPeso molecolare:4240.72Cortistatin 14, human, rat
CAS:<p>Cortistatin 14: a neuropeptide similar to somatostatin; induces sleep, depresses neuronal activity; found in cortex, hippocampus.</p>Formula:C81H113N19O19S2Purezza:98%Colore e forma:SolidPeso molecolare:1721.01Men 10208
CAS:<p>Men 10208 is an antagonist of the neurokinin A receptor.</p>Formula:C61H75N15O12Purezza:98%Colore e forma:SolidPeso molecolare:1210.36[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2
CAS:<p>[Arg-15,-20,-21, Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic analogue of PACAP 1-27 that exhibits a relaxant effect [1].</p>Formula:C157H253N53O42Colore e forma:SolidPeso molecolare:3555.02Angiopeptin TFA
CAS:Angiopeptin TFA: somatostatin analogue, sst2/sst5 partial agonist (IC50: 0.26/6.92 nM), suppresses GH & IGF-1, for atherosclerosis research.Formula:C58H73F6N11O14S2Colore e forma:SolidPeso molecolare:1326.39PACAP (1-27), human, ovine, rat
CAS:PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats.Formula:C142H224N40O39SPurezza:98%Colore e forma:SolidPeso molecolare:3147.66Dapiglutide
CAS:<p>Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.</p>Colore e forma:SolidCB1R agonist 1
<p>CB1R agonist 1 (Compound '1350) is a potent full agonist of the cannabinoid-1 receptor (CB1R) with a Ki value of 0.95 nM. It demonstrates significant pain-relieving effects in various pain models, including acute thermal pain, inflammatory pain, and neuropathic pain.</p>Formula:C20H18F3N3O3SColore e forma:SolidPeso molecolare:437.435Orexin B, rat, mouse TFA
<p>Orexin B, rat/mouse TFA, activates OX1-R & OX2-R receptors, influencing food intake, energy, and sleep regulation.</p>Formula:C128H216F3N45O36SColore e forma:SolidPeso molecolare:3050.42Orforglipron hemicalcium hydrate
CAS:<p>Orforglipron hemicalcium hydrate (LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate) represents the hemicalcium hydrate form of the calcium salt of Orforglipron, an orally active agonist targeting the Glucagon-like peptide-1 receptor (GLP-1R). This compound has demonstrated efficacy in mitigating type 2 diabetes [1].</p>Formula:C48H48F2N10O5Ca·H2OColore e forma:SolidPeso molecolare:921.023-Deoxyglucosone
CAS:3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with proteinFormula:C6H10O5Purezza:95%Colore e forma:SolidPeso molecolare:162.14Icatibant
CAS:<p>Icatibant is a selective and specific antagonist of the bradykinin B2 receptor (IC50 and Ki: 1.07 nM and 0.798 nM respectively).</p>Formula:C59H89N19O13SPurezza:98%Colore e forma:White SolidPeso molecolare:1304.52Hemopressin(rat)
CAS:<p>Peptide inhibitor for ep24.15, neurolysin & ACE with Ki 27.76, 3.43, 1.87 μM. Lowers blood pressure, modulates CB1 receptor, reduces pain & food intake.</p>Formula:C53H77N13O12Purezza:98%Colore e forma:SolidPeso molecolare:1088.27BAY-747
CAS:<p>BAY-747: oral, brain-penetrant sGC stimulator; improves rat memory, cognition, lowers blood pressure, aids Duchenne muscular dystrophy.</p>Formula:C22H26F2N4O2Colore e forma:SolidPeso molecolare:416.46HDAC6-IN-49
<p>HDAC6-IN-49 (Compound 3) is an inhibitor of HDAC, with IC50 values of 0.012 and 0.735 µM against HDAC6 and HDAC1, respectively. Additionally, it inhibits MAO-B, cholinesterase (ChE), histamine receptor (H3R), and serotonin 6 receptor (5-HT6R). HDAC6-IN-49 exhibits neuroprotective effects in SH-SY5Y cells and enhances cognitive functions and motor abilities in fruit fly models of Parkinson's disease and C. elegans models of Alzheimer's disease.</p>Colore e forma:Odour SolidS 16474
CAS:S 16474 is an antagonist of Neurokinin-1 Receptor.Formula:C44H48N6NaO8Purezza:98%Colore e forma:SolidPeso molecolare:811.892Cenderitide
CAS:<p>Cenderitide fuses CNP with DNP, stimulates pGC-A/B, ups cGMP, curbs aldosterone, and aids GFR, not affecting BP—used in heart failure studies.</p>Formula:C158H263N49O50S3Colore e forma:SolidPeso molecolare:3745.27(3R,5R,6S)-Atogepant
<p>(3R,5R,6S)-Atogepant (MK-8031) is a CGRP antagonist enantiomer used in migraine research.</p>Formula:C29H23F6N5O3Colore e forma:SolidPeso molecolare:603.52ZL-1101
<p>ZL-1101 is a human monoclonal antibody (mAb) targeting TNFRSF4/OX40/CD134.</p>Colore e forma:Odour LiquidMelanostatin, frog
CAS:<p>Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2].</p>Formula:C189H285N53O57SColore e forma:SolidPeso molecolare:4243.67DOAM
CAS:<p>DOAM is an antagonist of the 5-HT2 receptor.</p>Formula:C16H27NO2Colore e forma:SolidPeso molecolare:265.39Bay 55-9837 TFA
<p>Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.</p>Formula:C150H240F3ClN44O44Colore e forma:SolidPeso molecolare:3456.22Succinate/succinate receptor antagonist 1
CAS:<p>Potent succinate receptor antagonist with IC50 of 20 μM; blocks gingival succinate signaling, may treat periodontal disease.</p>Formula:C17H15N3OPurezza:99.53%Colore e forma:SoildPeso molecolare:277.32(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat)
CAS:<p>(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) is a corticotropin-releasing factor (CRF) antagonist known to counteract the inhibitory effects of IL-1a</p>Formula:C159H267N49O43Colore e forma:SolidPeso molecolare:3553.12INCB 3284 dimesylate
CAS:INCB 3284 dimesylate: oral CCR2 antagonist, blocks MCP-1/hCCR2 binding (IC50: 3.7 nM), potential in acute liver failure research.Formula:C28H39F3N4O10S2Purezza:98%Colore e forma:SolidPeso molecolare:712.76GRL018-21
<p>GRL018-21 is a potent, highly selective inhibitor of G protein-coupled receptor kinase 5 (GRK5), exhibiting an IC50 of 10 nM [1].</p>Colore e forma:Odour Solid5-HT2C agonist-4
CAS:<p>Compound 3i, a 5-HT2C agonist-4, acts as an agonist for the 5-HT2C receptor with an EC50 of 5.7 nM. It is capable of reducing locomotor activity in zebrafish larvae.</p>Formula:C24H25N5OColore e forma:SolidPeso molecolare:399.49(2R,2R)-PF-07258669
CAS:<p>(2R,2R)-PF-07258669' is an antagonist for the MC4R (melanocortin 4 receptor), primarily studied for its role in regulating appetite and energy expenditure.</p>Formula:C25H27FN6O2Colore e forma:SolidPeso molecolare:462.52[Lys4] Sarafotoxin S6c
CAS:<p>[Lys4] Sarafotoxin S6c: potent partial endothelin receptor agonist; causes pig coronary contraction, EC50=1.5 nM.</p>Formula:C105H153N27O36S5Colore e forma:SolidPeso molecolare:2529.82Kisspeptin-10, rat
CAS:<p>Kisspeptin-10, rat is an Endogenous ligand for the rodent kisspeptin receptor (KISS1, GPR54).</p>Formula:C63H83N17O15Purezza:98%Colore e forma:SolidPeso molecolare:1318.44MK-7246 S enantiomer
MK-7246 S enantiomer is a potent and selective CRTH2 antagonist.Formula:C21H21FN2O4SPurezza:98%Colore e forma:SolidPeso molecolare:416.4712(S)-HpEPE
CAS:<p>12(S)-HpEPE, a fatty acid created by 12-lipoxygenase on EPA, has unclear biological activities but may resemble 12(S)-HpETE.</p>Formula:C20H30O4Colore e forma:SolidPeso molecolare:334.456[Phe8Ψ(CH-NH)-Arg9]-Bradykinin
CAS:<p>Selective bradykinin B2 receptor agonist that is resistant to carboxypeptidase cleavage.</p>Formula:C50H75N15O10Purezza:98%Colore e forma:SolidPeso molecolare:1046.23Urocortin III (human)
CAS:<p>Urocortin III, a human peptide, binds CRF-R2, affecting insulin via somatostatin feedback with K i values 13.5-100+ nM.</p>Formula:C185H307N53O50S2Colore e forma:SolidPeso molecolare:4137.93Besipirdine hydrochloride
CAS:<p>Besipirdine hydrochloride is a non-receptor-dependent cholinomimetic compound with cardiovascular activity that inhibits the uptake of biogenic amines.</p>Formula:C16H18ClN3Purezza:98.45%Colore e forma:SoildPeso molecolare:287.79Baloncibart
CAS:<p>Baloncibart is a human IgG4K monoclonal antibody that targets NPR1.</p>Colore e forma:LiquidRF9 acetate
<p>RF9 acetate is an effective and selective antagonist of Neuropeptide FF receptor with Ki values of 58 and 75 nM for hNPFF1R and hNPFF2R, respectively.</p>Formula:C28H42N6O5Purezza:99.77%Colore e forma:SolidPeso molecolare:542.67FR 113680
CAS:FR 113680 is a tripeptide substance P antagonist with NK1 receptor selectivity.Formula:C35H39N5O6Purezza:98%Colore e forma:SolidPeso molecolare:625.726FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Colore e forma:SolidPeso molecolare:3692.15Haloperidol D4
CAS:<p>Haloperidol D4 is deuterium-labeled haloperidol.</p>Formula:C21H23ClFNO2Purezza:98%Colore e forma:SolidPeso molecolare:379.89RXFP3/4 agonist 1
CAS:<p>RXFP3/4 agonist 1 is a relaxin family peptide 3/4 receptor (RXFP3/4) agonist(EC50s of 82/2 nM, respectivley).</p>Formula:C20H22ClN5OPurezza:98%Colore e forma:SolidPeso molecolare:383.88Neurokinin B (TFA)
CAS:<p>Neurokinin B TFA, a tachykinin, targets NK1R, NK2R, nk3r GPCRs, modulating effects.</p>Formula:C59H81F6N13O18S2Purezza:98%Colore e forma:SolidPeso molecolare:1438.47NSC380324
<p>NSC380324 is a P2Y12 receptor antagonist with antiplatelet properties, which can be employed in research on atherosclerotic cardiovascular diseases.</p>Formula:C31H24N4O4Colore e forma:SolidPeso molecolare:516.55Antipsychotic agent-2
<p>Compound 11: potent antipsychotic, binds 5-HT1A/2A/2C, D2, H1 receptors; K is 56.6-1140 nM, BBB permeable.</p>Formula:C22H26FN5OColore e forma:SolidPeso molecolare:395.47Neuropeptide Y (3-36) (porcine)
CAS:<p>Neuropeptide Y (3-36) (porcine) is a potent, selective agonist at NPY Y2 receptors, increasing feeding in rats.</p>Formula:C176H271N53O54Colore e forma:SolidPeso molecolare:3993.36Agaridoxin
CAS:<p>Agaridoxin is a mushroom metabolite.</p>Formula:C11H14N2O5Colore e forma:SolidPeso molecolare:254.24212-epi Leukotriene B4
CAS:LTB4 is made enzymatically (12(R)-specific) and non-enzymatically (6-trans-12-epi mix). 12-epi LTB4 has low receptor activity.Formula:C20H32O4Colore e forma:SolidPeso molecolare:336.472dCNP
<p>dCNP binds to NPR-B/C receptors (NPR-B/C receptor), initiating the cGMP signaling pathway and regulating vascular function. It exhibits anti-hypoxic effects by downregulating hypoxia-related genes such as HIF1α and HIF2α. Additionally, dCNP inhibits tumor stroma induction, demonstrating antifibrotic properties. It also enhances immune response by upregulating CTL, NK cells, and conventional type 1 dendritic cells in tumors.</p>Formula:C141H248N38O36S3Colore e forma:SolidPeso molecolare:3147.91Cetirizine Impurity D
CAS:<p>Cetirizine Impurity D, an antihistamine derivative, acts as a long-lasting H1-receptor antagonist with antiallergic effects.</p>Formula:C30H28Cl2N2Colore e forma:SolidPeso molecolare:487.46GLP-1 moiety from Dulaglutide
<p>GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.</p>Formula:C149H221N37O49Purezza:98%Colore e forma:SolidPeso molecolare:3314.62Hemopressin (human, mouse)
CAS:<p>Endogenous peptide, inhibits ep24.15/24.16/ACE with Ki of 27.76/3.43/1.87 μM. Lowers blood pressure, CB1 inverse agonist, reduces pain in vivo.</p>Formula:C50H79N13O12Purezza:98%Colore e forma:SolidPeso molecolare:1054.26[Ala17]-MCH acetate
<p>[Ala17]-MCH acetate is a selective ligand for MCHR1 with a Ki of 0.16 nM and Kd of 0.37 nM(Eu3+ chelate-labeled).</p>Formula:C99H159N29O28S4Purezza:98.92%Colore e forma:SolidPeso molecolare:2331.76Calcitonin (human)
CAS:<p>Endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.</p>Formula:C151H226N40O45S3Purezza:98%Colore e forma:White Lyophilized PowderPeso molecolare:3417.87Setmelanotide Acetate(920014-72-8 free base)
CAS:<p>Setmelanotide Acetate(920014-72-8 free base) (RM-493 Acetate) is a selective agonist of melanocortin 4 receptor (MC4R)(human and rat MC4R with EC50s of 0.27 nM</p>Formula:C51H72N18O11S2Purezza:99.71%Colore e forma:SolidPeso molecolare:1177.351a,1b-dihomo Prostaglandin E1
CAS:<p>1a,1b-dihomo Prostaglandin E1 is a class of prostaglandin compounds.</p>Formula:C22H38O5Colore e forma:SolidPeso molecolare:382.541CAY10580
CAS:<p>CAY10580 is a potent and selective prostaglandin EP 4 receptor agonist ( K i =35 nM).</p>Formula:C19H35NO4Colore e forma:SolidPeso molecolare:341.49[Leu31,Pro34]-Neuropeptide Y(human,rat)
CAS:<p>High affinity neuropeptide Y Y1 receptor agonist (Ki = 0.39 nM). Also shows affinity for Y4 and Y5 receptors.</p>Formula:C189H284N54O56SPurezza:98%Colore e forma:SolidPeso molecolare:4241DOTA-LM3 TFA
<p>DOTA-LM3 TFA is a somatostatin receptor (SSTR) antagonist with the molecular structure p-Cl-Phe-cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH2.</p>Formula:C71H94ClF3N16O21S2Colore e forma:SolidPeso molecolare:1664.18EP4 receptor antagonist 3
CAS:<p>EP4 receptor antagonist 3 from patent WO2010019796 A1 targets EP4 for research on pain, arthritis, and cancer.</p>Formula:C26H21F3N2O3SColore e forma:SolidPeso molecolare:498.52PG106 TFA
<p>PG106 TFA is a potent hMC3 antagonist (IC50=210 nM), inactive at hMC4 (EC50=9900 nM) and hMC5 receptors.</p>Formula:C53H70F3N13O11Colore e forma:SolidPeso molecolare:1122.2Adenosine 3'-monophosphate (sodium salt hydrate)
<p>Adenosine 3'-monophosphate (sodium salt hydrate) (3'-AMP) is a nucleotide and cAMP-generating agonist that elevates cAMP levels in NG108-15 cells.</p>Formula:C10H15N5NaO8PColore e forma:SolidPeso molecolare:387.22Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Formula:C188H276N51F3O61Purezza:98%Colore e forma:SolidPeso molecolare:4283.5SB-408124
CAS:SB408124: Non-peptide, OX1 receptor antagonist, Ki 57 nM (whole cell) and 27 nM (membrane), 50x more selective than OX2.Formula:C19H18F2N4OPurezza:99.81%Colore e forma:SolidPeso molecolare:356.37L-797,591
CAS:<p>L-797,591 is a selective agonist of somatostatin receptor subtype 1.</p>Formula:C38H49N5O2Colore e forma:SolidPeso molecolare:607.83LY 344864 racemate
CAS:<p>LY 344864 racemate is a 5-HT1F receptor agonist.</p>Formula:C21H22FN3OPurezza:99.75%Colore e forma:SoildPeso molecolare:351.42PF-232798
CAS:<p>PF-232798 is a second generation oral CCR5 antagonist with potent broad-spectrum anti-HIV-1 activity.</p>Formula:C29H40FN5O2Colore e forma:SolidPeso molecolare:509.66Orexin A (human, rat, mouse)
CAS:Orexin A, a 33 AA neuropeptide in humans, rats, mice, influences various processes, studied in pancreatic function and as an OX1R antagonist.Formula:C152H243N47O44S4Purezza:98%Colore e forma:SolidPeso molecolare:3561.116-phenoxy tetranor Prostaglandin F2α methyl ester
CAS:<p>Prostaglandin F2α (PGF2α) drives luteolysis and smooth muscle contraction by activating the FP receptor.</p>Formula:C23H32O6Colore e forma:SolidPeso molecolare:404.503Cannabidiolic acid methyl ester
CAS:<p>Cannabidiolic acid methyl ester (HU-580) is an orally active analogue of cannabidiolic acid. It enhances the activation of 5-HT1A receptors and increases the expression of c-Fos and NeuN in specific hypothalamic nuclei in rats. Cannabidiolic acid methyl ester exhibits anti-nausea, anxiolytic, and anti-nociceptive effects.</p>Formula:C23H32O4Colore e forma:SolidPeso molecolare:372.5SphK1&2-IN-1
CAS:<p>SphK1&2-IN-1 is a sphingosine kinase inhibitor with anti-inflammatory, antitumor and hemostatic effects.</p>Formula:C14H14N2O3SPurezza:99.59%Colore e forma:SolidPeso molecolare:290.34Imelciment
CAS:<p>Imelciment (REGN-9035) is a humanised monoclonal antibody targeting NPR1, which can be used for research into heart failure.</p>Purezza:95%Colore e forma:Soild[Ala2] Endothelin-3, human
CAS:<p>[Ala2] Endothelin-3, a linear ET-3 analog with Ala replacing Cys, stimulates endothelial cell migration.</p>Formula:C120H166N26O32S4Colore e forma:SolidPeso molecolare:2613.02Atrial natriuretic factor (1-28) (rat) TFA
<p>ANP (1-28), rat (TFA) inhibits Ang II-induced endothelin-1 secretion; main circulating ANP form in rats.</p>Formula:C130H206N45F3O41S2Purezza:98%Colore e forma:SolidPeso molecolare:3176.43Dipivefrin
CAS:<p>Dipivefrin is a prodrug of epinephrine, and is used to treat open-angle glaucoma.</p>Formula:C19H29NO5Colore e forma:SolidPeso molecolare:351.44MGV354
<p>MGV354 is a soluble activator of guanylate cyclase(sGC) with EC 50 s of <0.5 nM, and 5 nM in CHO and GTM-3 E cells, respectively [1] [2].</p>Formula:C35H37N5O3Purezza:98%Colore e forma:SolidPeso molecolare:575.7(Ala13)-Apelin-13
CAS:(Ala13)-Apelin-13 is a useful organic compound for research related to life sciences. The catalog number is T35374 and the CAS number is 568565-11-7.Formula:C63H107N23O16SPurezza:98%Colore e forma:SolidPeso molecolare:1474.75[Ala1,3,11,15]-Endothelin
CAS:<p>Selective ETB endothelin receptor agonist (IC50 values are 0.33 and 2200 nM for displacing [125I]-ET-1 from ETB and ETA receptors respectively).</p>Formula:C109H163N25O32SPurezza:98%Colore e forma:SolidPeso molecolare:2368AB21 HCl
<p>AB21 HCl: σ1 receptor antagonist, Ki 13 nM; less potent at σ2 (102 nM). Reduces mechanical hypersensitivity.</p>Formula:C23H29ClN2OPurezza:99.91%Colore e forma:SolidPeso molecolare:384.2Xaliproden
CAS:Xaliproden is a biochemical.Formula:C24H22F3NColore e forma:SolidPeso molecolare:381.43Neuropeptide Y (18-36) (porcine)
CAS:<p>"Neuropeptide Y (18-36) (porcine) is a NPY heart receptor blocker, halts I-NPY binding, aids in heart failure research."</p>Formula:C112H174N36O27Colore e forma:SolidPeso molecolare:2456.8α1A-AR Degrader 9c
CAS:<p>α1A-AR Degrader 9c is a potent, selective, and reversible PROTAC degrader targeting the α1A adrenergic receptor (α1A-AR) with a DC50 of 2.86 μM.</p>Formula:C38H43N11O11Purezza:98%Colore e forma:SolidPeso molecolare:829.82α-Helical CRF(9-41) TFA
<p>α-Helical CRF(9-41) TFA acts as a competitive antagonist for the CRF2 receptor, possessing a binding constant (K B) of approximately 100 nM.</p>Formula:C168H275F3N46O55S2Colore e forma:SolidPeso molecolare:3940.42J-115814
CAS:<p>J-115814 is a potent feeding stimulant.</p>Formula:C29H38ClN5O3SColore e forma:SolidPeso molecolare:572.16Cyclic AC253
<p>Cyclic AC253 is an amylin receptor antagonist with an IC50 of 0.3 μM. It offers neuroprotective effects against Aβ toxicity and mitigates Aβ-induced impairments in hippocampal long-term potentiation. Additionally, Cyclic AC253 is capable of penetrating the blood-brain barrier.</p>Formula:C126H202N42O40S2Peso molecolare:3007.45049ANQ-11125 TFA
<p>ANQ-11125 TFA is a motilin antagonist with a pKd of 8.24, inhibiting motilide contractions in rabbits.</p>Formula:C88H126F3N19O23Colore e forma:SolidPeso molecolare:1875.05Cortistatin 14, human, rat acetate
Cortistatin 14, human, rat acetate is a neuropeptide having structural similarity to somatostatin-14 and shows anticonvulsive, neuroprotective effects andFormula:C80H112N18O19S2Purezza:97.86%Colore e forma:SolidPeso molecolare:1693.98PHM-27 (human)
CAS:<p>Human-derived peptide, VIP/PHM 27 analog, boosts insulin by targeting calcitonin receptor with an EC50 of 11 nM.</p>Formula:C135H214N34O40SPurezza:98%Colore e forma:SolidPeso molecolare:2985.44Pellotine
CAS:<p>Pellotine is an alkaloid isolated from Lophophora. It acts as an inverse agonist of the 5-HT7 receptor (5-HT7 receptor), with an EC50 of 291 nM. Pellotine shows strong affinity for the 5-HT1DR and 5-HT6R, with Ki values of 117 nM and 170 nM, respectively. Additionally, Pellotine reduces intracellular cAMP levels, thereby decreasing neuronal excitability and neurotransmitter release.</p>Formula:C13H19NO3Colore e forma:SolidPeso molecolare:237.295LAS190792
CAS:<p>LAS190792 (AZD8999) is a dual muscarinic antagonist/β2-agonist, pIC50s (M1-M5, β1-β3): 8.9-5.6; used as a bronchodilator.</p>Formula:C39H43ClN4O9S2Colore e forma:SolidPeso molecolare:811.36Gastrin I, rat
CAS:<p>Gastrin I, rat is a peptide hormone that effectively stimulates gastric acid secretion.</p>Formula:C94H128N22O31S2Colore e forma:SolidPeso molecolare:2126.3[Asu1,6-Arg8]Vasopressin
CAS:<p>[Asu1,6-Arg8]Vasopressin, a vasopressin agonist, boosts cAMP and ACTH release in cultured rat pituitary cells.</p>Formula:C48H68N14O12Colore e forma:SolidPeso molecolare:1033.145-Bromoimidazo[1,2-A]Pyrazine
CAS:<p>5-Bromoimidazo[1,2-a]pyrazine inhibits phosphodiesterase and beta-adrenergic receptors.5-Bromoimidazo[1,2-a]pyrazine shows antibronchospastic activity in vitro.</p>Formula:C6H4BrN3Purezza:97.04%Colore e forma:SolidPeso molecolare:198.02Eledoisin Related Peptide
CAS:<p>Eledoisin Related Peptide (Eledoisin RP) is a tachykinin receptor ligand.</p>Formula:C34H58N8O6SPurezza:98%Colore e forma:SolidPeso molecolare:706.94AZ7976
CAS:<p>AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].</p>Formula:C30H33F7N2O6SColore e forma:SolidPeso molecolare:682.65JKC363 TFA
<p>JKC363 TFA is an MC4 receptor antagonist with 90x more affinity than MC3 (IC50: 0.5 nM vs 44.9 nM), blocks α-MSH's effect on TRH, and is anti-hyperalgesic.</p>Formula:C71H93F3N19O18S2Colore e forma:SolidPeso molecolare:1620.73[Des-Arg10]-HOE I40 TFA
<p>[Des-Arg10]-HOE I40 TFA is a potent antagonist of the bradykinin B1 receptor.</p>Formula:C53H77N15O12S·xC2HF3O2Colore e forma:SolidPeptide YY (PYY), human
CAS:<p>PYY: a 36-amino-acid hormone, amidated, part of neuroendocrine control, acts via Neuropeptide Y receptors.</p>Formula:C194H295N55O57Purezza:98%Colore e forma:SolidPeso molecolare:4309.75TAK-683 acetate
<p>TAK-683 acetate: potent KISS1R agonist (IC50=170 pM), stable, nonapeptide. Affects GnRH, FSH, LH, testosterone; potential in prostate cancer research.</p>Formula:C66H87N17O15Colore e forma:SolidPeso molecolare:1358.5PACAP (1-38) free acid TFA
<p>PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin</p>Colore e forma:Odour Solid17-phenyl trinor Prostaglandin F2α cyclopropyl methyl amide
CAS:<p>Prostaglandin F2α (PGF2α) activates the FP receptor, promoting smooth muscle contraction and luteolysis.</p>Formula:C27H39NO4Colore e forma:SolidPeso molecolare:441.612CCK Octapeptide, non-sulfated acetate
<p>CCK Octapeptide, non-sulfated acetate is a synthetic desulfated peptide of cholecystokinin.</p>Formula:C51H66N10O15S2Purezza:98.9700%Colore e forma:SolidPeso molecolare:1123.26Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
<p>Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.</p>Formula:C165H252N44O48SColore e forma:SolidPeso molecolare:3652.1Ceruletide Ammonium Salt
<p>Ceruletide Ammonium Salt is a decapeptide, originating from the skin of tropical frogs, which is a potent cholecystokinin receptor agonist and a safe and</p>Formula:C58H77N14O21S2Purezza:98.47% - 98.54%Colore e forma:SoildPeso molecolare:1370.44Losulazine
CAS:<p>Losulazine: a new antihypertensive, requires functional sympathetic nervous system; mechanism undefined.</p>Formula:C27H22F4N4O3SPurezza:98.83%Colore e forma:SolidPeso molecolare:558.55Chemerin-9, Mouse
CAS:<p>Chemokine-like receptor 1 (CMKLR1) agonist (EC50 = 42 nM). Corresponds to C-terminal of full length mouse Chemerin, amino acids 148 - 156.</p>Formula:C51H68N10O12Colore e forma:SolidPeso molecolare:1013.163Cagrilintide
CAS:<p>Cagrilintide: a long-acting amylin analogue, potential obesity treatment, reduces appetite and weight.</p>Formula:C194H312N54O59S2Colore e forma:SolidPeso molecolare:4409.01BA 1 TFA
<p>BA1 TFA agonizes BB receptors; binds BRS3, GRPR, NMBR with IC50s of 6, 0.4, 2.5 nM.</p>Formula:C59H77F3N14O13Colore e forma:SolidPeso molecolare:1247.32CRF, bovine
CAS:CRF, bovine is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM.Formula:C206H340N60O63SPurezza:98%Colore e forma:SolidPeso molecolare:4697.34Osanetant
CAS:Osanetant produces anxiolytic- and antidepressant-like effects. Osanetant is a selective NK3 receptor antagonist. It is researched for schizophrenia.Formula:C35H41Cl2N3O2Purezza:98%Colore e forma:SolidPeso molecolare:606.62Pasireotide
CAS:Pasireotide (SOM 230) is a cyclohexapeptide, mimicking somatostatin with high affinity for sst1/2/3/4/5 receptors (pKi=8.2/9.0/9.1/<7.0/9.9).Formula:C58H66N10O9Purezza:98%Colore e forma:SolidPeso molecolare:1047.21L-threo Lysosphingomyelin (d18:1)
CAS:<p>L-threo Lysosphingomyelin, a natural S1P receptor agonist, has EC50s: 19.3 nM (hS1P1), 131.8 nM (hS1P3), 313.3 nM (hS1P2).</p>Formula:C23H49N2O5PColore e forma:SolidPeso molecolare:464.62(S, R)-LSN 3318839
CAS:<p>(S,R)-LSN 3318839 enhances GLP-1R, shows strong blood sugar lowering in animals, works with sitagliptin.</p>Formula:C26H23Cl2N3O2Purezza:99.57%Colore e forma:SoildPeso molecolare:480.39Angiopeptin
CAS:<p>Angiopeptin is a synthetic octapeptide analog of somatostatin; suppresses accelerated transplant atherosclerosis in rabbit heart arteries.</p>Formula:C54H71N11O10S2Colore e forma:SolidPeso molecolare:1098.34SGLT1/2-IN-2
CAS:<p>SGLT1/2-IN-2 is a chemical compound with robust dual inhibitory properties, exhibiting potent activities against SGLT1 (IC50 = 96 nM) and SGLT2 (IC50 = 1.3 nM).</p>Formula:C23H26F2O7Colore e forma:SolidPeso molecolare:452.451Neuropeptide Y (3-36) (human, rat)
CAS:<p>Neuropeptide Y (3-36) is a Y2 receptor agonist that limits norepinephrine release, produced by DPP4 from NPY.</p>Formula:C175H269N53O54SColore e forma:SolidPeso molecolare:4011.5[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH
CAS:<p>[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH is a synthetic LHRH analog and a GnRH receptor antagonist.</p>Formula:C67H84N16O13Colore e forma:SolidPeso molecolare:1321.48Retrobradykinin
CAS:<p>Bradykinin analog nonapeptide. Reverse sequence of Bradykinin. Exhibits no significant kinin activity. Can be used as a negative control.</p>Formula:C50H73N15O11Colore e forma:SolidPeso molecolare:1060.228VIP36
<p>VIP36 is an agonist of the cannabinoid type 1 receptor (CB1) with analgesic properties. It reduces the recruitment of inhibitory proteins, thereby exerting its pain-relieving effects, and is applicable in research related to chronic pain.</p>Formula:C27H35FN6O4Colore e forma:SolidPeso molecolare:526.603S(-)-Bisoprolol fumarate
CAS:<p>S(-)-Bisoprolol fumarate is a selective β1-blocker for hypertension and heart research.</p>Formula:C18H31NO4·xC4H4O4Colore e forma:SolidPeso molecolare:441.521ALD1613
<p>ALD1613 is a potent neutralizing monoclonal antibody targeting adrenocorticotropic hormone (ACTH). It neutralizes ACTH-induced signaling and inhibits cyclic adenosine monophosphate accumulation in ACTH-stimulated Y1 (mouse adrenal cell line) via all five melanocortin receptors. ALD1613 significantly reduces plasma corticosterone levels in wild-type rats and is applicable in studies involving elevated ACTH-related conditions.</p>Colore e forma:Odour LiquidSB-206606
CAS:<p>SB-206606 is a novel, highly specific radioactive ligand for the β3-adrenergic receptor.</p>Formula:C19H22ClNO4Colore e forma:SolidPeso molecolare:363.83Poly-D-lysine hydrobromide (MW 1000-5000)
<p>Poly-D-lysine hydrobromide (PDLHB) (MW 1000-5000) is a synthetically produced polymeric substrate widely used in neural cell culture. Additionally, Poly-D-lysine hydrobromide acts as a CaSR agonist peptide.</p>Colore e forma:Odour SolidMRS2500 tetraammonium
CAS:<p>Highly potent and selective antagonist of the platelet P2Y1 receptor</p>Formula:C13H21IN6O8P2Purezza:98%Colore e forma:SolidPeso molecolare:578.19Serazapine
CAS:<p>Serazapine is a highly specific serotonin (5-HT2) binding inhibitor with anxiolytic activity for the treatment of anxiety disorders.</p>Formula:C22H23N3O2Purezza:98.71% - 99.57%Colore e forma:SolidPeso molecolare:361.44Amylin (8-37), human
CAS:<p>Human-derived Amylin (8-37) is a vasodilator in rat arteries and forms aggregates linked to type II diabetes.</p>Formula:C138H216N42O45Colore e forma:SolidPeso molecolare:3183.495Cinnamtannin A2
CAS:<p>Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.</p>Formula:C60H50O24Colore e forma:SolidPeso molecolare:1155.02(D-Phe6,Leu-NHEt13,des-Met14)-Bombesin (6-14)
CAS:<p>(D-Phe6,Leu-NHEt13,des-Met14)-Bombesin (6-14), a bombesin (BBN) antagonist, holds potential for cancer research applications [1].</p>Formula:C49H69N13O9Colore e forma:SolidPeso molecolare:984.15Galanin Receptor Ligand M35
CAS:<p>M35, a galanin(1-13)-bradykinin(2-9) amide, acts as a galanin antagonist in rats and inhibits mouse pancreatic islets.</p>Formula:C107H153N27O26Purezza:98%Colore e forma:SolidPeso molecolare:2233.6GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Formula:C46H47FN8O7SColore e forma:SolidPeso molecolare:874.98Triazolomethylindole-3-acetic acid
CAS:<p>Triazolomethylindole-3-acetic acid is a metabolite of Rizatriptan, which acts as an agonist for the serotonin (5-HT) receptor subtypes 5-HT1B and 5-HT1D.</p>Formula:C13H12N4O2Colore e forma:SolidPeso molecolare:256.26(S)-Azelastine hydrochloride
CAS:<p>(S)-Azelastine HCl, an antihistamine, reduces H1R, M1R, M3R levels and inhibits HNEpC growth.</p>Formula:C22H25Cl2N3OPurezza:98%Colore e forma:SolidPeso molecolare:418.36Efranarelaxin alfa
CAS:<p>Efranarelaxin alfa is an agonist of the relaxin receptor. It shows potential for research in cardiovascular diseases and tissue repair.</p>Colore e forma:LiquidAdrenocorticotropic Hormone (ACTH) (1-39), rat
CAS:ACTH (1-39), rat: potent MC2 agonist, forms fragments in vitro, isolated by HPLC, characterized by amino acids and NH2-terminus.Formula:C210H315N57O57SPurezza:98%Colore e forma:SolidPeso molecolare:4582.23JKC363
CAS:<p>MC4 receptor antagonist; IC50: 0.5 nM (MC4), 44.9 nM (MC3). Blocks α-MSH, reduces TRH, food intake, and pain.</p>Formula:C69H91N19O16S2Purezza:98%Colore e forma:SolidPeso molecolare:1506.72Zebrafish Kisspeptin-1
CAS:<p>Zebrafish Kisspeptin-1 is the core sequence of the neuropeptide kisspeptin-1, which plays a crucial role in regulating the release of gonadotropin-releasing hormone (GnRH) and modulating the reproductive system.</p>Formula:C58H84N16O15Colore e forma:SolidPeso molecolare:1245.39Tizanidine
CAS:<p>Tizanidine, an α2-adrenergic receptor agonist, suppresses the release of neurotransmitters from central nervous system (CNS) noradrenergic neurons.</p>Formula:C9H8ClN5SPurezza:99.11%Colore e forma:White SolidPeso molecolare:253.71Sufotidine
CAS:<p>Sufotidine (AH 25352X) is a highly selective competitive H2 receptor antagonist.</p>Formula:C20H31N5O3SPurezza:99.03% - 99.92%Colore e forma:SolidPeso molecolare:421.56Syk Inhibitor II hydrochloride
CAS:<p>Syk signaling is key in lupus. Syk inhibitors reduce inflammation and sepsis severity in FcgRIIb-/- mice, lowering cytokines and organ damage.</p>Formula:C14H16ClF3N6OPurezza:99.05%Colore e forma:SolidPeso molecolare:376.77Kisspeptin-54(human)
CAS:Endogenous ligand for KISS1 receptor; Ki values: rat 1.80 nM, human 1.45 nM. Inhibits tumor spread, stimulates gonadotropin release.Formula:C258H401N79O78Purezza:98%Colore e forma:SolidPeso molecolare:5857.49Dulaglutide
CAS:<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Colore e forma:SolidPF-07062119
<p>PF-07062119 is a humanized immunoglobulin G1 (IgG1) monoclonal antibody designed to target and inhibit GUCY2C.</p>Colore e forma:Odour Liquidσ1R-IN-1
σ1R-IN-1 ((R,R)-1a) is an effective σ-1R inhibitor with an IC50 of 110 nM. It shows promising potential for use in research related to neuropsychiatric disorders.Formula:C15H22N2Colore e forma:SolidPeso molecolare:230.35MrgprX2 antagonist-2
CAS:<p>MrgprX2 antagonist-2, from patent WO2021092262A1 E163, is potent for skin inflammation studies.</p>Formula:C17H16F5N3O3Colore e forma:SolidPeso molecolare:405.325CAP-100
<p>CAP-100 is a monoclonal antibody targeting CCR7. It neutralizes the ligand binding site and signaling of CCR7. This compound effectively inhibits migration, extravasation, homing, and survival in chronic lymphocytic leukemia (CLL) samples induced by CCR7. CAP-100 can mediate potent tumor cell killing through host immune mechanisms and exhibits favorable toxicity profiles in related hematopoietic cell subsets. It is involved in research on antitumor activity and diseases like chronic lymphocytic leukemia (CLL).</p>Colore e forma:Odour LiquidPancreatic polypeptide TFA
<p>Pancreatic polypeptide TFA acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.</p>Colore e forma:Odour Solid(R)-Preclamol hydrochloride
CAS:<p>(R)-Preclamol HCl is a dopamine agonist stimulating both auto and postsynaptic receptors.</p>Formula:C14H22ClNOColore e forma:SolidPeso molecolare:255.78α-CGRP(human) TFA
<p>α-CGRP(human) TFA is a 37-amino acid regulatory neuropeptide that is extensively located within the central and peripheral nervous system, functioning as a</p>Formula:C165H268F3N51O51S2Colore e forma:SolidPeso molecolare:3903.33Enuvaptan
CAS:<p>Enuvaptan is a vasopressin receptor antagonist and has the potential for research into renal and cardiovascular diseases.</p>Formula:C21H15ClF6N8O3Colore e forma:SolidPeso molecolare:576.84Xanthine amine congener dihydrochloride
CAS:<p>XAC dihydrochloride is an Adenosine A1 and A2 receptor antagonist with IC50s of 1.8 nM and 114 nM, also a mouse convulsant.</p>Formula:C21H30Cl2N6O4Colore e forma:SolidPeso molecolare:501.41EP3 antagonist 4
CAS:<p>EP3 antagonist 4: hEP inhibitor, Ki = 2 nM, low clearance, high oral AUC, good bioavailability in rats, potential for diabetes research.</p>Formula:C22H20Cl3FN4O3S2Purezza:98%Colore e forma:SoildPeso molecolare:577.91Luteinizing Hormone Releasing Hormone (LH-RH), salmon
CAS:LH-RH: a hypothalamus-made pituitary hormone, key in reproductive control.Formula:C60H73N15O13Purezza:98%Colore e forma:SolidPeso molecolare:1212.31Cinanserin hydrochloride
CAS:<p>Cinanserin hydrochloride (SQ 10643) is a 5-HT2 receptor blocker (Ki: 41 nM) and SARS-CoV 3C-like protease inhibitor.</p>Formula:C20H25ClN2OSPurezza:99.57%Colore e forma:SolidPeso molecolare:376.94tBPC
CAS:<p>Enhances Y4R response to PP, NPY & PYY with EC50 of 0.03, 0.4, 0.5 nM; selective for Y4R over Y1R, Y2R, Y5R.</p>Formula:C16H24O2Colore e forma:SolidPeso molecolare:248.36Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Formula:C148H224N40O45·xC2HF3O2Colore e forma:SolidPG 106 acetate
<p>PG 106 acetate: Selective hMC3 receptor antagonist, IC50=210 nM; inactive on hMC5 and hMC4, EC50=9900 nM.</p>Formula:C53H73N13O11Purezza:98.24%Colore e forma:SolidPeso molecolare:1068.23HAEGTFTSDVS acetate
<p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>Formula:C50H75N13O22Purezza:97.47%Colore e forma:SolidPeso molecolare:1210.2SR-31747 free base
CAS:SR-31747: immunosuppressive anti-inflammatory agent, inhibits cell growth by blocking sterol isomerase.Formula:C23H34ClNColore e forma:SolidPeso molecolare:359.98Tirzepatide hydrochloride
Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.Formula:C225H349N48O68ClPurezza:98%Colore e forma:SolidPeso molecolare:4849.91Orexin B, human
CAS:Orexin B, human agonizes Orexin receptors (OX1 Ki=420 nM, OX2 Ki=36 nM), promotes feeding in rats, and is a neuropeptide.Formula:C123H212N44O35SPurezza:98%Colore e forma:SolidPeso molecolare:2899.34BIBP3226
CAS:<p>BIBP3226 is a potent and selective antagonist for the Neuropeptide Y receptor Y1 and the neuropeptide FF receptor.</p>Formula:C27H31N5O3Colore e forma:SolidPeso molecolare:473.57LP 12 hydrochloride
CAS:<p>LP 12 hydrochloride is a selective 5-HT7 receptor agonist (Ki=0.13 nM).</p>Formula:C32H40ClN3OColore e forma:SolidPeso molecolare:518.14Big Gastrin I (human) TFA
<p>BigGastrinI, human (TFA), is a gastrointestinal hormone comprised of 34 amino acids. It can serve as a potential substance in the study of conditions such as cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological disorders, or cardiovascular diseases.</p>Formula:C178H252F3Peso molecolare:2446.96712GS-2278
CAS:<p>GS-2278 is an antagonist of LPAR1 (lysophosphatidic acid receptor 1) with potential applications in the study of idiopathic pulmonary fibrosis (IPF).</p>Formula:C22H16F5N9O3Colore e forma:SolidPeso molecolare:549.41Neuropeptide Y (human) free acid
CAS:<p>Neuropeptide Y (human) free acid is the deamidated form of Neuropeptide Y (human, rat, mouse). The amidation of the C-terminal tyrosine in Neuropeptide Y is essential for its function, while the non-amidated form cannot initiate G-protein signaling.</p>Formula:C189H284N54O58SPeso molecolare:4270.06542Dopamine D2 receptor agonist-2
CAS:<p>Dopamine D2 receptor agonist-2 (Dopamine D2 Receptor) is a ligand targeting the dopamine D2 receptor.</p>Formula:C25H31Cl2N5OSPurezza:98.93%Colore e forma:SoildPeso molecolare:520.52Substance P (1-9)
CAS:<p>Substance P (1-9), a nonapeptide, slows its own inactivation and stimulates neurons.</p>Formula:C52H77N15O12Purezza:98%Colore e forma:SolidPeso molecolare:1104.26palm-PrRP31
palm-PrRP31 is a potent dual agonist for GPR10 (EC50=72 pM) and NPFF-R2. It activates downstream signaling pathways by binding to GPR10 and NPFF-R2 receptors, leading to reduced appetite and increased energy expenditure. palm-PrRP31 can be utilized to investigate its mechanism of action in the nervous system, thereby elucidating the complex biological processes involved in the regulation of appetite and energy expenditure.Formula:C176H282N56O43SPeso molecolare:3900.1322[Nle11]-Substance P
CAS:<p>'[Nle11]-Substance P is a gut and brain peptide, resisting methionine oxidation and causing excitatory neural effects.'</p>Formula:C64H100N18O13Purezza:98%Colore e forma:SolidPeso molecolare:1329.59Lys-γ3-MSH(human)
CAS:<p>Pro-opiomelanocortin (POMC) derived peptide that stimulates lipolysis</p>Formula:C128H193N45O39SPurezza:98%Colore e forma:SolidPeso molecolare:3018.258-iso-15-keto Prostaglandin F2α
CAS:<p>8-iso-15-keto Prostaglandin F2α (8-iso-15-keto PGF2α) is a metabolite of the isoprostane 8-iso PGF2α in rabbits, monkeys, and humans.</p>Formula:C20H32O5Colore e forma:SolidPeso molecolare:352.471Veldoreotide
CAS:Veldoreotide (Somatoprim): a somatostatin analogue targeting receptors 2, 4, 5, reduces GH in pituitary adenomas.Formula:C60H74N12O10Purezza:98%Colore e forma:SolidPeso molecolare:1123.3Exendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Formula:NAPurezza:98%Colore e forma:SolidPeso molecolare:3055.49IRL-1038 acetate
<p>IRL-1038 acetate is a potent ETB endothelin receptor antagonist.</p>Formula:C70H96N14O17S2Purezza:97.51%Colore e forma:SoildPeso molecolare:1469.73TRPV1/CB2 agonist 1
<p>TRPV1/CB2 agonist 1 (compound 41) is a dual agonist targeting hTRPV1 and CB2 receptors, with an EC50 value of 26.8 μM for hTRPV1. It is applicable in research related to the nervous system.</p>Colore e forma:Odour Solid[D-Phe12,Leu14]-Bombesin
CAS:<p>Bombesin receptor blocker; stops binding in rat brain (IC50=2 μM), hinders amylase release (IC50=4 μM), reduces appetite suppression in vivo.</p>Formula:C77H113F3N22O20Purezza:98%Colore e forma:SolidPeso molecolare:1724.9Cafelkibart
<p>Cafelkibart is a chimeric IgG1κ monoclonal antibody targeting CCR8, with HumanIgG1kappa, Isotype Control serving as its corresponding isotype control.</p>Colore e forma:Odour LiquidNebokitug
<p>Nebokitug is a humanized IgG1κ antibody targeting CCL24, with HumanIgG1kappa, Isotype Control serving as its corresponding isotype control.</p>Colore e forma:Odour LiquidCloprostenol isopropyl ester
CAS:<p>(+)-Chloprostol is a PGF2α agonist, mimics prostaglandin F2α, induces luteal dissolution in mares without side effects or stress.</p>Formula:C25H35ClO6Colore e forma:SolidPeso molecolare:466.99Wy 43657
CAS:<p>Wy 43657 is a gonadorelin antagonist.</p>Formula:C71H86N14O13Purezza:98%Colore e forma:SolidPeso molecolare:1343.554RS 18286
CAS:<p>RS 18286 is a LHRH antagonist.</p>Formula:C74H101Cl2N17O14Colore e forma:SolidPeso molecolare:1523.6Abediterol napadisylate
CAS:<p>Abediterol napadisylate is a novel long-acting β2-agonist in persistent asthma that is efficacy, safe, and tolerable.</p>Formula:C60H68F4N4O14S2Purezza:98%Colore e forma:SolidPeso molecolare:1209.32MDL 19301
CAS:MDL 19301 is a nonsteroidal, anti-inflammatory agent.Formula:C15H21NS2Purezza:98%Colore e forma:SolidPeso molecolare:279.46Vapiprost
CAS:<p>Vapiprost is an antagonist of the thromboxane receptor and a prostaglandin receptor.</p>Formula:C30H39NO4Purezza:98%Colore e forma:SolidPeso molecolare:477.64Neuropeptide Y 13-36 (porcine)
CAS:<p>Neuropeptide Y 13-36 (porcine) is a selective neuropeptide Y2 receptor agonist.</p>Formula:C135H209N41O36Colore e forma:SolidPeso molecolare:2982.408JNJ-10181457 (hydrochloride)
CAS:<p>JNJ-10181457 (hydrochloride) is a non-imidazole H3 receptor antagonist that is brain-penetrating and selective, increasing NE and acetylcholine concentrations</p>Formula:C20H30Cl2N2OColore e forma:SolidPeso molecolare:385.37HTL22562
CAS:<p>HTL22562 is a calcitonin gene-related peptide (CGRP) receptor antagonist for acute treatment of migraine.</p>Formula:C40H49N11O5Colore e forma:SolidPeso molecolare:763.904Bz-Dab(nbd)-awfpp-nle-NH2
CAS:<p>Bz-Dab(nbd)-ala-trp-phe-pro-pro-nle-NH2 is a fluorescent NK2 antagonist.</p>Formula:C56H65N13O11Colore e forma:SolidPeso molecolare:1096.2M1145
CAS:<p>Potent GAL2 agonist with EC50 = 38 nM; Ki: 6.55 nM (GAL2), 497 nM (GAL3), 587 nM (GAL1); enhances galanin signaling.</p>Formula:C128H205N37O32Purezza:98%Colore e forma:SolidPeso molecolare:2774.26LY83583
CAS:<p>LY83583 is a soluble guanylate cyclase competitive inhibitor with IC50 of 2 µM.</p>Formula:C15H10N2O2Purezza:99.54% - 99.80%Colore e forma:SolidPeso molecolare:250.25Anti-TSHR Antibody (M22)
<p>Anti-TSHR Antibody (M22) is a humanized IgG1 monoclonal antibody targeting the thyroid-stimulating hormone receptor (TSHR). This antibody is capable of inhibiting the interaction between TSH and TSHR.</p>Colore e forma:Odour LiquidOrexin A (human, rat, mouse) (TFA)
Endogenous orexin receptor agonist with Ki of 20 nM (OX1) and 38 nM (OX2), promotes feeding, may regulate sleep-wake cycle.Formula:C154H244N47F3O46S4Purezza:98%Colore e forma:SolidPeso molecolare:3675.12Gulgafafusp alfa
CAS:<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Colore e forma:LiquidRamelteon metabolite M-II
CAS:<p>Ramelteon M-II binds MT1/MT2 with IC50s: 208/1470 pM; it's the main metabolite and a melatonin receptor agonist.</p>Formula:C16H21NO3Purezza:98%Colore e forma:SolidPeso molecolare:275.34
![[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT83510.webp&w=3840&q=75)
![[Lys4] Sarafotoxin S6c](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76302.webp&w=3840&q=75)
![[Phe8Ψ(CH-NH)-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2076.webp&w=3840&q=75)
![[Ala17]-MCH acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1997L.webp&w=3840&q=75)
![[Leu31,Pro34]-Neuropeptide Y(human,rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1985.webp&w=3840&q=75)
![[Ala2] Endothelin-3, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76305.webp&w=3840&q=75)
![[Ala1,3,11,15]-Endothelin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2099.webp&w=3840&q=75)
![[Asu1,6-Arg8]Vasopressin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76510.webp&w=3840&q=75)
![5-Bromoimidazo[1,2-A]Pyrazine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT77641.webp&w=3840&q=75)
![[D-Glp1,D-Phe2,D-Trp3,6]-LH-RH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76350.webp&w=3840&q=75)
![[Nle11]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1831.webp&w=3840&q=75)
![[D-Phe12,Leu14]-Bombesin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1916.webp&w=3840&q=75)
