Proteina G/GPCR
Gli inibitori dei GPCR/proteine G sono composti che bersagliano i recettori accoppiati alle proteine G (GPCR) e le proteine G associate, che svolgono ruoli critici nella trasmissione dei segnali dall'esterno all'interno delle cellule. Questi inibitori sono essenziali per studiare le vie di segnalazione mediate dai GPCR, coinvolte in numerosi processi fisiologici, tra cui la percezione sensoriale, la risposta immunitaria e la neurotrasmissione. Gli inibitori dei GPCR sono anche importanti nello sviluppo di farmaci, poiché molti agenti terapeutici prendono di mira questi recettori. Presso CymitQuimica, offriamo una vasta gamma di inibitori dei GPCR/proteine G di alta qualità per supportare le tue ricerche in farmacologia, biologia cellulare e campi correlati.
Sottocategorie di "Proteina G/GPCR"
- recettore 5-HT(942 prodotti)
- Recettore dell'adenosina(242 prodotti)
- Recettore adrenergico(2.949 prodotti)
- Recettore della bombesina(30 prodotti)
- Recettore della bradichinina(59 prodotti)
- CXCR(149 prodotti)
- CaSR(32 prodotti)
- Recettore dei cannabinoidi(195 prodotti)
- Recettore della dopamina(410 prodotti)
- Recettore dell'endotelina(75 prodotti)
- Recettore GNRH(73 prodotti)
- GPCR19(31 prodotti)
- GRK(32 prodotti)
- GTPase(21 prodotti)
- Recettore del glucagone(166 prodotti)
- Proteina Hedgehog/Smoothened(45 prodotti)
- Recettore dell'istamina(359 prodotti)
- Recettore LPA(21 prodotti)
- Recettore della melatonina(24 prodotti)
- Recettore OX(40 prodotti)
- Recettore degli oppioidi(298 prodotti)
- PAFR(11 prodotti)
- PKA(49 prodotti)
- Recettore S1P(17 prodotti)
- SGLT(30 prodotti)
- Recettore Sigma(46 prodotti)
Mostrare 18 più sottocategorie
Trovati 5378 prodotti di "Proteina G/GPCR"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
L-803087 TFA
CAS:<p>L-803087 TFA: potent sst4 agonist, Ki=0.7 nM, >280x selective vs other somatostatin receptors; boosts AMPA, heightens seizures.</p>Formula:C27H30F5N5O5Colore e forma:SolidPeso molecolare:599.55ACT-1016-0707
CAS:<p>ACT-1016-0707 is a selective, insurmountable LPA1 antagonist with antifibrotic and anti-inflammatory activity in lung fibrosis models</p>Formula:C19H23ClN4O4SPurezza:99.905%Colore e forma:SolidPeso molecolare:438.93Antisauvagine-30
CAS:<p>CRF2 receptor antagonist; Kd 1.4 nM (mCRF2β), 153.6 nM (rCRF1). Blocks sauvagine-induced cAMP in cells & stress-related responses in mice.</p>Formula:C161H274N48O46SPurezza:98%Colore e forma:SolidPeso molecolare:3650.29PG-931
CAS:Selective MC4 agonist with IC50: 0.58 nM (MC4), 55 nM (MC3); revives heart/lung function in shocked rats.Formula:C59H85N15O11Purezza:98%Colore e forma:SolidPeso molecolare:1180.41Peptide YY (pig)
CAS:<p>Peptide YY (pig), a 36 amino acid gut peptide from porcine duodenum, reduces appetite via Y2 receptor, affecting digestion and the heart.</p>Formula:C190H288N54O57Colore e forma:SolidPeso molecolare:4240.72Hemokinin 1, human TFA
<p>Hemokinin-1 is a human TFA and selective NK1 agonist; also activates NK2 & NK3 and induces opioid-independent analgesia.</p>Formula:C56H85F3N14O16SColore e forma:SolidPeso molecolare:1299.42Osanetant
CAS:Osanetant produces anxiolytic- and antidepressant-like effects. Osanetant is a selective NK3 receptor antagonist. It is researched for schizophrenia.Formula:C35H41Cl2N3O2Purezza:98%Colore e forma:SolidPeso molecolare:606.624-fluoro MBZP
CAS:<p>4-fluoro MBZP is a novel psychoactive substance in the phenylpiperazine class, utilized for studies on the 5-HT2 receptors in the central nervous system.</p>Formula:C12H17FN2Colore e forma:SolidPeso molecolare:208.28(-)-Eseroline fumarate
CAS:<p>(-)-Eseroline fumarate, a Physostigmine metabolite and AChE inhibitor, triggers cancer cell LDH release and neuronal cell death.</p>Formula:C17H22N2O5Colore e forma:SolidPeso molecolare:334.37[Leu31,Pro34]-Neuropeptide Y(human,rat)
CAS:<p>High affinity neuropeptide Y Y1 receptor agonist (Ki = 0.39 nM). Also shows affinity for Y4 and Y5 receptors.</p>Formula:C189H284N54O56SPurezza:98%Colore e forma:SolidPeso molecolare:4241LY83583
CAS:<p>LY83583 is a soluble guanylate cyclase competitive inhibitor with IC50 of 2 µM.</p>Formula:C15H10N2O2Purezza:99.54% - 99.80%Colore e forma:SolidPeso molecolare:250.25Anti-TSHR Antibody (M22)
<p>Anti-TSHR Antibody (M22) is a humanized IgG1 monoclonal antibody targeting the thyroid-stimulating hormone receptor (TSHR). This antibody is capable of inhibiting the interaction between TSH and TSHR.</p>Colore e forma:Odour LiquidFabesetron
CAS:<p>Fabesetron (FK1052): oral dual antagonist for 5-HT3/5-HT4 receptors. Aids in managing acute and delayed chemo-induced emesis.</p>Formula:C18H19N3OColore e forma:SolidPeso molecolare:293.37Dipivefrin
CAS:<p>Dipivefrin is a prodrug of epinephrine, and is used to treat open-angle glaucoma.</p>Formula:C19H29NO5Colore e forma:SolidPeso molecolare:351.44Pellotine
CAS:<p>Pellotine is an alkaloid isolated from Lophophora. It acts as an inverse agonist of the 5-HT7 receptor (5-HT7 receptor), with an EC50 of 291 nM. Pellotine shows strong affinity for the 5-HT1DR and 5-HT6R, with Ki values of 117 nM and 170 nM, respectively. Additionally, Pellotine reduces intracellular cAMP levels, thereby decreasing neuronal excitability and neurotransmitter release.</p>Formula:C13H19NO3Colore e forma:SolidPeso molecolare:237.2955-MeO-pyr-T
CAS:<p>5-MeO-pyr-T (5-Methoxy pyrrolidinyltryptamine) acts as a 5-HT1AR agonist, exhibiting Ki values of 0.577 μM and 373 μM for 5-HT1AR and 5-HT2AR, respectively. It inhibits the reuptake of 5-HT and triggers its release. Additionally, 5-MeO-pyr-T can induce reduced motor activity.</p>Formula:C15H20N2OColore e forma:SolidPeso molecolare:244.33Cortagine
<p>Potent CRF1 agonist, EC50 = 0.18 nM in rats. Exhibits in vivo anxiolytic and antidepressant effects; reduces mouse defensive behavior.</p>Formula:C192H323N55O63SPurezza:98%Colore e forma:SolidPeso molecolare:4442.06Nafetolol
CAS:<p>Nafetolol (K 5407) is a biochemical reagent that can be used to synthesize other compounds.</p>Formula:C19H29NO3Purezza:98.91%Colore e forma:SolidPeso molecolare:319.44[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2
CAS:<p>[Arg-15,-20,-21, Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic analogue of PACAP 1-27 that exhibits a relaxant effect [1].</p>Formula:C157H253N53O42Colore e forma:SolidPeso molecolare:3555.02PG106 TFA
<p>PG106 TFA is a potent hMC3 antagonist (IC50=210 nM), inactive at hMC4 (EC50=9900 nM) and hMC5 receptors.</p>Formula:C53H70F3N13O11Colore e forma:SolidPeso molecolare:1122.2GB-6
CAS:<p>GB-6, a short linear peptide that selectively binds to the gastrin releasing peptide receptor (GRPR), shows potential as a high-contrast imaging probe due to</p>Formula:C32H45N11O8Purezza:98%Colore e forma:SolidPeso molecolare:711.77TRV045
CAS:<p>TRV045 is a selective agonist of the sphingosine-1-phosphate (S1P) subtype 1 receptor and does not impact lymphocyte trafficking. It possesses antiepileptic properties.</p>Formula:C18H18N4O3Colore e forma:SolidPeso molecolare:338.36ABT 724 trihydrochloride
CAS:<p>ABT-724 trihydrochloride: selective D4 agonist; EC50=12.4nM(human),14.3nM(rat),23.2nM(ferret); for erectile dysfunction research.</p>Formula:C17H22Cl3N5Purezza:99.91%Colore e forma:SolidPeso molecolare:402.75GR231118
CAS:<p>Potent NPY Y1 antagonist & Y4 agonist; inhibits rat appetite; binds to NPFF receptors (Ki: 43-73 nM).</p>Formula:C110H170N34O24Purezza:98%Colore e forma:Lyophilized PowderPeso molecolare:2352.77Albiglutide Fragment
CAS:<p>Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).</p>Formula:C148H224N40O45Purezza:98%Colore e forma:SolidPeso molecolare:3283.6K-(D-1-Nal)-FwLL-NH2 TFA
<p>K-(D-1-Nal)-FwLL-NH2 TFA: potent ghrelin inverse agonist; Ki=4.9 nM (COS7), 31 nM (HEK293T); blocks Gq/G13 signaling.</p>Formula:C53H68F3N9O8Colore e forma:SolidPeso molecolare:1016.16PAR 4 (1-6)
CAS:<p>PAR 4 (1-6) can be used for relevant research in the life sciences. Its product number is T36293 and CAS number is 225779-44-2.</p>Formula:C28H41N7O9Colore e forma:SolidPeso molecolare:619.676EP4 receptor antagonist 3
CAS:<p>EP4 receptor antagonist 3 from patent WO2010019796 A1 targets EP4 for research on pain, arthritis, and cancer.</p>Formula:C26H21F3N2O3SColore e forma:SolidPeso molecolare:498.52PAR-4 Agonist Peptide, amide acetate
<p>PAR-4 Agonist Peptide, amide acetate is an agonist of proteinase-activated receptor-4 (PAR-4).</p>Formula:C36H52N8O9Purezza:98%Colore e forma:SolidPeso molecolare:740.865-Bromoimidazo[1,2-A]Pyrazine
CAS:<p>5-Bromoimidazo[1,2-a]pyrazine inhibits phosphodiesterase and beta-adrenergic receptors.5-Bromoimidazo[1,2-a]pyrazine shows antibronchospastic activity in vitro.</p>Formula:C6H4BrN3Purezza:97.04%Colore e forma:SolidPeso molecolare:198.02LUF6096
CAS:<p>LUF6096 (CF-602) is a potent allosteric enhancer of the adenosine A3 receptor, exhibiting the capability to enhance agonist binding allosterically while</p>Formula:C22H21Cl2N3OPurezza:99.5%Colore e forma:SolidPeso molecolare:414.33PROTAC(H-PGDS)-8
CAS:<p>PROTAC(H-PGDS)-8 is a PROTAC degrader targeting Hematopoietic prostaglandin D synthase (H-PGDS), exhibiting an IC50 of 0.14 μM [1].</p>Formula:C41H40N8O7Colore e forma:SolidPeso molecolare:756.81IRL-1038 acetate
<p>IRL-1038 acetate is a potent ETB endothelin receptor antagonist.</p>Formula:C70H96N14O17S2Purezza:97.51%Colore e forma:SoildPeso molecolare:1469.73Ki16198
CAS:<p>Ki16198, a methyl ester derivative of Ki16425, blocks LPA1/3, weak on LPA2; inactive on LPA4/5/6. Ki values: 0.34 μM (LPA1), 0.93 μM (LPA3).</p>Formula:C24H25ClN2O5SPurezza:98.09%Colore e forma:SolidPeso molecolare:488.98Neurokinin B
CAS:<p>NKB, a tachykinin peptide, impacts human functions like gonadotropin-releasing hormone secretion.</p>Formula:C55H79N13O14S2Purezza:98%Colore e forma:SolidPeso molecolare:1210.42[D-Phe12]-Bombesin
CAS:<p>Bombesin receptor antagonist</p>Formula:C74H112N22O18SPurezza:98%Colore e forma:SolidPeso molecolare:1629.88Orexin B, human
CAS:Orexin B, human agonizes Orexin receptors (OX1 Ki=420 nM, OX2 Ki=36 nM), promotes feeding in rats, and is a neuropeptide.Formula:C123H212N44O35SPurezza:98%Colore e forma:SolidPeso molecolare:2899.34Bombinakinin M acetate
<p>Bombinakinin M acetate is a potent bradykinin receptor agonist with high selectivity for mammalian arterial smooth muscle bradykinin receptors and is</p>Formula:C102H163N31O26Purezza:99.80%Colore e forma:SolidPeso molecolare:2239.58IRAK inhibitor 4 trans
<p>IRAK inhibitor 4 targets and blocks IRAK4 activity; refers to its trans molecular configuration.</p>Formula:C33H35F3N6O3Purezza:98%Colore e forma:SolidPeso molecolare:620.664-Chloromethamphetamine hydrochloride
CAS:<p>4-Chloromethamphetamine hydrochloride is a novel psychoactive substance belonging to the amphetamine class.</p>Formula:C10H15Cl2NColore e forma:SolidPeso molecolare:220.14Fenoldopam
CAS:<p>Fenoldopam is a selective D1-like dopamine receptor partial agonist (EC50 = 57 nM).</p>Formula:C16H16ClNO3Purezza:98%Colore e forma:SolidPeso molecolare:305.76L-threo Lysosphingomyelin (d18:1)
CAS:<p>L-threo Lysosphingomyelin, a natural S1P receptor agonist, has EC50s: 19.3 nM (hS1P1), 131.8 nM (hS1P3), 313.3 nM (hS1P2).</p>Formula:C23H49N2O5PColore e forma:SolidPeso molecolare:464.62HS014
CAS:Potent MC4 antagonist; Ki: 3.16 nM (MC4), 108 (MC1), 54.4 (MC3), 694 (MC5). Boosts rat appetite, mouse pain, blocks IL-1β Fos in hypothalamus.Formula:C71H94N20O17S2Purezza:98%Colore e forma:SolidPeso molecolare:1563.77PF-232798
CAS:<p>PF-232798 is a second generation oral CCR5 antagonist with potent broad-spectrum anti-HIV-1 activity.</p>Formula:C29H40FN5O2Colore e forma:SolidPeso molecolare:509.66Blue FPG-A trisodium
CAS:<p>Blue FPG-A trisodium is a P2X1 & P2Y1 receptor antagonist, IC50: 35.5 μM & 2.6 μM, related to RB2.</p>Formula:C29H17ClN7Na3O11S3Colore e forma:SolidPeso molecolare:840.19-deoxy-9-methylene Prostaglandin E2
CAS:<p>9-deoxy-9-methylene PGE2: stable PGE2 analog with similar effects, less side effects, equal potency in rats, gerbils, primates.</p>Formula:C21H34O4Colore e forma:SolidPeso molecolare:350.499FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Colore e forma:SolidPeso molecolare:3692.15Noladin ether
CAS:<p>Noladin ether (2-AG ether) is a cannabinoid CB1 receptor agonist.</p>Formula:C23H40O3Colore e forma:SolidPeso molecolare:364.56Pexopiprant
CAS:<p>Pexopiprant, a potent oral antagonist of the prostaglandin D2 receptor 2 (DP2) with a K i value less than 100nM, is a valuable compound for asthma research.</p>Formula:C21H17Cl2F2NO4Colore e forma:SolidPeso molecolare:456.27M1145
CAS:<p>Potent GAL2 agonist with EC50 = 38 nM; Ki: 6.55 nM (GAL2), 497 nM (GAL3), 587 nM (GAL1); enhances galanin signaling.</p>Formula:C128H205N37O32Purezza:98%Colore e forma:SolidPeso molecolare:2774.26
![[Leu31,Pro34]-Neuropeptide Y(human,rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1985.webp&w=3840&q=75)
![[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT83510.webp&w=3840&q=75)
![5-Bromoimidazo[1,2-A]Pyrazine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT77641.webp&w=3840&q=75)
![[D-Phe12]-Bombesin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2239.webp&w=3840&q=75)
