Bioquímicos e reagentes
Os bioquímicos e reagentes são substâncias fundamentais para a pesquisa e desenvolvimento em campos como biotecnologia, biologia molecular, farmacologia e medicina. Esses produtos são essenciais para uma variedade de aplicações, incluindo a síntese de compostos, a análise de amostras biológicas, a pesquisa de processos metabólicos e a produção de medicamentos. Na CymitQuimica, oferecemos uma ampla seleção de bioquímicos e reagentes de alta qualidade e pureza, adequados para diversas necessidades científicas e industriais. Nosso catálogo inclui enzimas, anticorpos, ácidos nucleicos, aminoácidos e muitos outros produtos, todos projetados para apoiar pesquisadores e profissionais em seus projetos de pesquisa e desenvolvimento, garantindo resultados confiáveis e reproduzíveis.
Subcategorias de "Bioquímicos e reagentes"
- Biomoléculas(99.118 produtos)
- Por Alvo Biológico(99.156 produtos)
- Por uso/Efeitos Farmacológicos(6.788 produtos)
- Compostos relacionados à criopreservação e aos crioconservantes(21 produtos)
- Desinfetantes, aditivos para aquecimento de líquidos de banho e compostos relacionados(28 produtos)
- Hormónios(346 produtos)
- Biologia Vegetal(6.748 produtos)
- Metabólitos secundários(14.233 produtos)
Foram encontrados 130579 produtos de "Bioquímicos e reagentes"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
gp100 (178-187)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H71N11O14S2Peso molecular:1,018.23 g/molCorticotropin Releasing Factor, human, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C208H344N60O63S2Peso molecular:4,757.44 g/molPRRS-PQGAB-C
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H90N16O19Peso molecular:1,423.56 g/molBiotin-Pancreatic Polypeptide, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C195H301N55O56S3Peso molecular:4,407.99 g/molα-Gliadin (57-73)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C93H136N22O27Peso molecular:1,994.25 g/molCalcitonin N-Terminal Flanking Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C264H426N74O97SPeso molecular:6,220.84 g/molAZD4205
CAS:<p>AZD4205 is an investigational therapeutic agent, which is a small molecule inhibitor developed by AstraZeneca. It is designed to target specific signaling pathways involved in cancer cell proliferation and survival. The source of AZD4205 lies in the meticulous synthesis of a compound specifically engineered to interfere with aberrant molecular processes within cancer cells.</p>Fórmula:C25H31N9O2Pureza:Min. 95%Peso molecular:489.57 g/molIGF-I (30-41)
CAS:<p>Please enquire for more information about IGF-I (30-41) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C51H83N19O19Pureza:Min. 95%Peso molecular:1,266.32 g/molβ-Amyloid (15-21)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H65N9O9Peso molecular:852.05 g/mol[D-Arg1,D-Pro2,D-Phe7,D-His9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H102N20O13SPeso molecular:1,427.75 g/molRES-701-1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H117N23O24Peso molecular:2,061.22 g/molDABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt
CAS:<p>Please enquire for more information about DABCYL-(Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-675)-EDANS ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C71H91N15O21SPureza:Min. 95%Peso molecular:1,522.64 g/molWS-12
CAS:<p>WS-12 is a low-potency antimicrobial agent that inhibits bacterial growth by disrupting the microbial membrane and cell wall. WS-12 is an aryl halide with a cationic side chain that binds to activated filaments, which disrupts the function of the cell membrane. The exact mechanism of how WS-12 interacts with cells is not known, but it has been shown to alter neuronal function, cause growth inhibition in cancer cells, and inhibit the polymerase chain reaction.</p>Fórmula:C18H27NO2Pureza:Min. 95%Peso molecular:289.41 g/molBicine
CAS:<p>Bicine, also known as N,N-Bis(2-hydroxyethyl)glycine, is a Bis(2-hydroxyethyl) amine buffer with an optimal pH range of 7.6-9.0 and a pKa of 8.26. This buffering agent forms metal complexes and is used in crystallization and enzymatic studies.</p>Fórmula:C6H13NO4Pureza:Min. 95%Cor e Forma:White SolidPeso molecular:163.17 g/molH-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt
CAS:<p>H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt is a casein that is used as a model system for pancreatic β-cells. It has been shown to induce cell apoptosis in malignant cells and sequences that are associated with the development of pancreatic cancer. H-Glu(Glu(Glu-OH)-OH)-OH trifluoroacetate salt also induces endothelial cell proliferation and decreases cell function, which may be due to its ability to promote uptake of this compound.</p>Fórmula:C15H23N3O10Pureza:Min. 95%Peso molecular:405.36 g/mol[Ile12, Val15] MUC5AC Analog 3
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H112N16O25Peso molecular:1,541.73 g/mol[Met5, Lys6] a-Neo-Endorphin (1-6)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H47N7O8SPeso molecular:701.85 g/molch-Relaxing Peptide (CARP)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H67N11O7S2Peso molecular:830.13 g/molγ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H51N11O8Peso molecular:705.82 g/molβ-Amyloid (1-34)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C170H253N47O52Peso molecular:3,787.20 g/molHydroxybupropion
CAS:Produto Controlado<p>Hydroxybupropion is a drug that is used to treat depressive disorders. It acts as a nicotinic acetylcholine receptor antagonist and a dopamine uptake inhibitor, which increases the levels of dopamine in the brain. It is also an antidepressant with clinical response after oral administration. The plasma concentration-time curve of hydroxybupropion can be found by using both the conventional single-phase linear regression method and a nonlinear mixed effects model. This drug may interact with other drugs, such as antidepressants and antipsychotics, and has been shown to increase their levels in the blood stream. Hydroxybupropion also interacts with drugs that affect metabolism, such as α1-acid glycoprotein, or are taken up by the liver, such as acetylcholinesterase inhibitors. The chemical stability of hydroxybupropion can be determined by examining its stereoselectivity for acetylcholine receptors, which is dependent on pH.</p>Fórmula:C13H18ClNO2Pureza:Min. 95%Peso molecular:255.74 g/mol[D-Met2,Pro5] Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C30H40N6O6SPeso molecular:612.75 g/mol[Asp5,6,Me-Phe8] Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H56N8O11SPeso molecular:857.00 g/molPF 05175157
CAS:<p>PF 05175157 is a potent small molecule, orally active inhibitor of fatty acid synthase (FAS) that causes hepatocyte steatosis in vitro and in vivo. PF 05175157 is also an inhibitor of the enzyme stearoyl-CoA desaturase 1 (SCD1), which converts saturated to monounsaturated fatty acids. The compound has been shown to reduce liver and body weight gain in mice fed a high-fat diet, as well as to improve dyslipidemia and hepatic steatosis. PF 05175157 has been evaluated clinically for the treatment of obesity, type 2 diabetes mellitus, and nonalcoholic fatty liver disease. PF 05175157 was granted orphan drug designation for the treatment of pediatric chronic kidney disease by the FDA on June 6, 2015.</p>Fórmula:C23H27N5O2Pureza:Min. 95%Peso molecular:405.49 g/molYK11
CAS:Produto Controlado<p>YK11 is a synthetic gene-selective androgen receptor modulator, which is derived from steroidal structures and designed to modulate specific pathways. This compound is characterized by its unique ability to act as a partial agonist/antagonist at the androgen receptor, with a focus on inhibiting the activity of myostatin, a regulatory protein that limits muscle growth.</p>Fórmula:C25H34O6Pureza:Min. 95%Peso molecular:430.53 g/molBiotin-Angiotensin I/II (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C51H76N14O13SPeso molecular:1,125.33 g/molDynorphin A (2-12), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C60H105N21O12Peso molecular:1,312.64 g/molα-Bag Cell Peptide (1-9)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H83N15O12Peso molecular:1,122.35 g/molZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:<p>Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.</p>Fórmula:C33H44N10O7•(HCl)xPureza:Min. 95%Peso molecular:692.77 g/molUremic Pentapeptide (U5-Peptide)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C32H48N8O9Peso molecular:688.8 g/molMca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C66H82N16O17SPureza:Min. 95%Peso molecular:1,403.52 g/molN,N'-1,2-ethanediylbis[N-[(2-hydroxyphenyl)methyl]-glycine
CAS:<p>N,N'-1,2-Ethanediylbis[N-[(2-hydroxyphenyl)methyl]-glycine is a research tool that is used to study the activation of receptors and ion channels. It can also be used to study protein interactions and pharmacology.</p>Fórmula:C20H24N2O6Pureza:Min. 95%Peso molecular:388.4 g/molAmyloid β-Protein (1-42) hydrochloride salt
CAS:<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514.04 g/molTrehalose 6-decanoate
CAS:<p>Trehalose 6-decanoate is a specialized sugar ester, which is a derivative of the disaccharide trehalose. It is synthesized typically through esterification processes involving enzymatic or chemical methods, where a decanoic acid chain is introduced to the trehalose molecule. This modification results in altered physicochemical properties compared to the native sugar.</p>Fórmula:C22H40O12Pureza:Min. 95%Peso molecular:496.55 g/molLys(Dabsyl)-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt
CAS:<p>Please enquire for more information about Lys(Dabsyl)-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-676)-Gln-Lucifer Yellow ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C89H122N24O31S3Pureza:Min. 95%Peso molecular:2,120.26 g/mol(Pyr 11)-Amyloid b-Protein (11-40)
CAS:<p>Please enquire for more information about (Pyr 11)-Amyloid b-Protein (11-40) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C143H226N38O39SPureza:Min. 95%Peso molecular:3,133.62 g/molGly-Amyloid b-Protein (15-25)-Gly-ε-aminocaproyl(-Lys)6
CAS:<p>Please enquire for more information about Gly-Amyloid b-Protein (15-25)-Gly-epsilon-aminocaproyl(-Lys)6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C105H178N28O26Pureza:Min. 95%Peso molecular:2,248.71 g/molVesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt
CAS:<p>Please enquire for more information about Vesicular Stomatitis Virus Nucleoprotein (52-59) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H66N12O12Pureza:Min. 95%Peso molecular:955.07 g/molAcetyl-Amyloid b/A4 Protein Precursor770 (96-110) (cyclized)
CAS:<p>Please enquire for more information about Acetyl-Amyloid b/A4 Protein Precursor770 (96-110) (cyclized) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C81H128N32O19S2Pureza:Min. 95%Peso molecular:1,918.22 g/molAmyloid β-Protein (1-43)
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-43) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C207H318N56O62SPureza:Min. 95%Peso molecular:4,615.15 g/molMca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-Lys(Dnp)
CAS:<p>Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-Lys(Dnp) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C51H67N11O21Pureza:Min. 95%Peso molecular:1,170.14 g/molFibronectin Type III Connecting Segment (1-25)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C123H195N31O39Peso molecular:2,732.04 g/molAbz-Amyloid β/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C69H114N26O18Pureza:Min. 95%Peso molecular:1,595.81 g/mol[Tyr22]-a-CGRP (22-37), rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C82H120N20O25Peso molecular:1,785.99 g/molBiotin-Neuromedin B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H87N17O14S2Peso molecular:1,358.62 g/molAmyloid Dan Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Dan Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C185H268N48O51S2Pureza:Min. 95%Peso molecular:4,044.53 g/molHerpes Virus Inhibitor 1
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H64N10O14Peso molecular:920.46 g/molFmoc-Ile-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Ile-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Z-His(Bzl)-OH
CAS:<p>Please enquire for more information about Z-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H21N3O4Pureza:Min. 95%Peso molecular:379.41 g/molHBsAg Mouse Monoclonal Antibody
<p>Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Dengue Virus Type 3 Envelope Antigen, Recombinant
<p>Please enquire for more information about Dengue Virus Type 3 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%For-Nle-Leu-Phe-Nle-Tyr-Lys-OH
CAS:<p>For-Nle-Leu-Phe-Nle-Tyr-Lys-OH is an amino acid sequence that is a proteolytic fragment of the erythrocyte membrane protein band 3. It has been shown to be able to inhibit the activity of cytosolic calcium and actin filament polymerization, as well as inhibiting apoptosis in human polymorphonuclear leukocytes (PMNL). This compound has been found to be effective in preventing uptake of bacteria by neutrophils, which may be due to its ability to alter the pH gradient across the membrane and increase intracellular calcium levels. For-Nle-Leu-Phe-Nle-Tyr-Lys-OH also inhibits diacylglycerol synthesis, which may contribute to its antiinflammatory effects.</p>Fórmula:C43H65N7O9Pureza:Min. 95%Peso molecular:824.02 g/molACY-775
CAS:<p>ACY-775 is a molecule that inhibits the growth of cancer cells. It has potent inhibitory activity against epidermal growth factor (EGF) and has been shown to be effective in treating brain infarction in cell cultures. ACY-775 has also been shown to have antidepressant response in clinical studies, which may be due to its ability to block serotonin reuptake. This drug also inhibits acid formation and synaptic dysfunction, which may contribute to its effect on depression. ACY-775 binds to lysine residues on the HER2+ breast cancer cells and inhibits their growth.</p>Fórmula:C17H19FN4O2Pureza:Min. 95%Peso molecular:330.36 g/molAmyloid β-Protein (1-38) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C184H277N51O56SPureza:Min. 95%Peso molecular:4,131.54 g/molH-D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2 (Disulfide bond between Cys2 and Pen7)
CAS:<p>H-D-Phe-Cys-Tyr-D-Trp-Orn-Thr-Pen-Thr-NH2 is a neuropeptide that was found in the brain of an amphibian and has been shown to have antinociceptive properties. The peptide has been shown to bind to kappa opioid receptors and δ opioid receptors, which are both involved in pain regulation. H-D-Phe-Cys-Tyr-D-Trp-Orn (HDFYDT) has been shown to be effective in vivo, which may be due to its ability to increase striatal dopamine levels and decrease locomotor activity. HDFYDT also increases gamma aminobutyric acid levels in the brain, which may result in reduced anxiety. HDFYDT is synthesized from two amino acids: histidine and glutamine. This peptide is sensitive to proteolytic enzymes and can be degraded into smaller fragments such</p>Fórmula:C50H67N11O11S2Pureza:Min. 95%Peso molecular:1,062.27 g/mol(Nle 35)-Amyloid b-Protein (1-40) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-40) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C195H297N53O58Pureza:Min. 95%Peso molecular:4,311.77 g/molAmyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Precursor Frameshift Mutant C-Terminal Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H81N17O16Pureza:Min. 95%Peso molecular:1,104.22 g/molAcetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-Amyloid b-Protein (15-20) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C42H63N9O8Pureza:Min. 95%Peso molecular:822.01 g/molAmyloid β/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C47H73N11O16SPureza:Min. 95%Peso molecular:1,080.21 g/molRosuvastatin
CAS:<p>Rosuvastatin is a synthetic lipid-lowering agent, which is a product of pharmaceutical manufacturing derived from extensive research in cardiovascular pharmacology. It functions as an HMG-CoA reductase inhibitor, effectively blocking the enzyme responsible for cholesterol biosynthesis in the liver. By inhibiting this enzyme, Rosuvastatin reduces the production of cholesterol, especially low-density lipoprotein (LDL) cholesterol, which is known to contribute to atherosclerosis.</p>Fórmula:C22H28FN3O6SPureza:Min. 95%Peso molecular:481.54 g/molSAR125844
CAS:<p>SAR125844 is a potent inhibitor of the tyrosine kinase activity of epidermal growth factor receptor (EGFR). It has been shown to inhibit tumor growth in animal models and inhibit cell proliferation in cancer cells. SAR125844 has been evaluated in clinical studies for the treatment of patients with prostate cancer, which is resistant to imatinib. The drug was found to be safe and well tolerated at doses up to 800 mg/day. Clinical response rates were observed in some patients who had experienced disease progression while on other therapies. SAR125844 inhibits tumor growth by targeting EGFR, which is an important cellular pathway that promotes cell proliferation and survival.</p>Fórmula:C25H23FN8O2S2Pureza:Min. 95%Peso molecular:550.63 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C195H300N56O56SPureza:Min. 95%Peso molecular:4,356.88 g/mol(Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H295N53O57S2Pureza:Min. 95%Peso molecular:4,345.87 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H73N13O10Peso molecular:980.20 g/molβ-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C25H47N5O6SPeso molecular:545.75 g/molBiotin-Kinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/mol(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS:<p>Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C204H313N55O60Pureza:Min. 95%Peso molecular:4,496 g/molMyosin Kinase Inhibiting Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H78N18O11Peso molecular:987.2 g/molPrepro-adrenomedullin (153-185), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C143H224N42O43Peso molecular:3,219.56 g/molCalpain inhibitor XII
CAS:<p>Inhibitor of calpain, a calcium-dependent cysteine protease which is implicated in the calcium-mediated processes such as apoptosis and neuronal membrane excitability. Calpain inhibitor XII has antiviral properties as it can inhibit the main protease Mpro (3CLpro) from SARS-CoV-2 with IC50 of 0.45 μM.</p>Fórmula:C26H34N4O5Pureza:Min. 95%Cor e Forma:PowderPeso molecular:482.57 g/mol[Val5,Asn9]-Angiotensin I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molDynorphin A (2-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H117N23O13Peso molecular:1,440.81 g/mol4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol
CAS:<p>4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol is a potent inhibitor of kinases and proteins in humans that has been shown to have anti-cancer properties. It is an analog of neopterin, a biomarker for immune activation and oxidative stress. This compound has been found to induce apoptosis in cancer cells and inhibit the growth of tumors. The 4-(5-Methanesulfonyl-(1,2,3,4)tetrazol-1-yl)-phenol inhibitor has also been shown to be effective against Chinese hamster ovary cells and various other kinases. In addition, it has potential therapeutic applications as an anticancer agent due to its ability to inhibit the proliferation of cancer cells. This compound can also be detected in urine samples and may serve as a useful diagnostic tool for certain diseases or conditions.</p>Fórmula:C8H8N4O3SPureza:Min. 95%Cor e Forma:PowderPeso molecular:240.24 g/molCathelicidin LL 37
CAS:<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>Fórmula:C205H340N60O53Pureza:Min. 95%Peso molecular:4,493.27 g/molCarassin (Carrassius Auratus)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/molHypertrehalosaemic Neuropeptide, Nauphoeta cinerea
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H67N13O14Peso molecular:1,074.19 g/molA-A-A-Y-G-G-F-L
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C37H52N8O10Peso molecular:768.87 g/molZ-Ala-Ser-OH
CAS:<p>Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.</p>Fórmula:C14H18N2O6Pureza:Min. 95%Cor e Forma:PowderPeso molecular:310.3 g/molBremelanotide
CAS:<p>Bremelanotide is a synthetic cyclic peptide, classified as a melanocortin receptor agonist. It is derived from the analogs of the alpha-melanocyte-stimulating hormone (α-MSH), with its origins in melanocortin system research. This product acts primarily through the activation of melanocortin 4 receptor (MC4R) pathways in the central nervous system.Bremelanotide exerts its physiological effects by stimulating these receptors, leading to increased neural signals related to sexual arousal and desire. The melanocortin receptors, especially MC4R, play a significant role in modulating various neural networks involved in sexual function.This compound is utilized primarily for the treatment of hypoactive sexual desire disorder (HSDD) in premenopausal women. By enhancing sexual desire and arousal, Bremelanotide provides a therapeutic option for individuals experiencing clinically significant distress related to low sexual desire. Its application in clinical settings highlights the potential of melanocortin pathways as therapeutic targets beyond their established roles in pigmentary and energy balance modulation.</p>Fórmula:C50H68N14O10Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:1,025.16 g/molPT-141
<p>TFA salt. Catalogue peptide; min. 95% purity</p>Fórmula:C50H68N14O10Peso molecular:1,025.20 g/molSuccinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
CAS:<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>Fórmula:C86H117N17O27Pureza:Min. 95%Peso molecular:1,820.95 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H296N54O57SPureza:Min. 95%Peso molecular:4,328.82 g/molEndotrophin (mouse) trifluoroacetate salt
CAS:<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>Fórmula:C345H520N92O106S7Pureza:Min. 95%Peso molecular:7,876.84 g/molRecombinant Measles virus Hemagglutinin glycoprotein(H)
<p>Please enquire for more information about Recombinant Measles virus Hemagglutinin glycoprotein(H) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:> 85%MMP-8 Substrate, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H63N13O13Peso molecular:1,042.14 g/molGlutaryl-Phe-AMC
CAS:<p>Glutaryl-Phe-AMC is a fluorophore that has been used to study dental plaque. It is an amide of glutaryl-Phe and AMC, which is a water molecule. Glutaryl-Phe-AMC is a synthetic molecule that can be deprotonated by histidine in the presence of d-homoserine. The fluorescence of this compound increases when it binds to the enzyme substrates, 7-amino-4-methylcoumarin (AMC) and water molecules. This assay can be used for studying proteolytic activity on enzymes such as protease and amylase.</p>Fórmula:C24H24N2O6Pureza:Min. 95%Peso molecular:436.46 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C35H40N4O7Pureza:Min. 95 Area-%Cor e Forma:PowderPeso molecular:628.71 g/mol[D-Lys3]-GHRP-6
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H63N13O6Peso molecular:930.13 g/molSildenafil
CAS:<p>Sildenafil is a pharmaceutical compound, which is a synthetic product derived from chemical processes. It functions as a selective inhibitor of the enzyme phosphodiesterase type 5 (PDE5). By inhibiting PDE5, sildenafil increases cyclic guanosine monophosphate (cGMP) levels within the smooth muscle cells of the corpus cavernosum. This leads to smooth muscle relaxation and vasodilation, allowing increased blood flow and facilitating penile erection in the presence of sexual stimulation.</p>Fórmula:C22H30N6O4SPureza:Min. 95%Cor e Forma:PowderPeso molecular:474.58 g/molPRGL493
CAS:<p>PRGL493 is a synthetic peptide that binds to the ion channel TRPC1 and inhibits its activity. It is used as a research tool in pharmacology, cell biology, and protein interactions. PRGL493 has been shown to inhibit the activation of TRPC1 by calcium ions, thereby inhibiting calcium-dependent signaling pathways. This drug also binds to and inhibits the function of other ion channels such as TRPC4, TRPV2, TRPV3, TRPM8, and TRPA1. PRGL493 is supplied as a lyophilized powder at 5mg per vial. The purity of this product is >98% by HPLC analysis.br> PRGL493 can be reconstituted with sterile water or buffer to produce a concentration of 10 µg/mL or 20 µg/mL in appropriate buffers.br> The reconstituted material should be stored at -20°C for no more than one month</p>Fórmula:C25H21N7O2Pureza:Min. 95%Peso molecular:451.5 g/molAngiotensin II (1-4), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C24H37N7O8Peso molecular:551.6 g/molBiotin-a-CGRP (canine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C172H276N52O54S3Peso molecular:4,032.63 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/molGW 0742
CAS:<p>Peroxisome proliferator-activated receptor PPARβ/ÎŽ agonist</p>Fórmula:C21H17F4NO3S2Pureza:Min. 95%Peso molecular:471.49 g/molVX 702
CAS:<p>p38 MAP kinase antagonist</p>Fórmula:C19H12F4N4O2Pureza:Min. 95%Cor e Forma:SolidPeso molecular:404.32 g/molNeostigmine methyl sulfate
CAS:<p>Inhibitor of acetylcholinesterase</p>Fórmula:C13H22N2O6SPureza:Min. 95%Cor e Forma:PowderPeso molecular:334.39 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H197N39O30Peso molecular:2,570 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H35N5O5·HClPureza:Min. 95%Peso molecular:534.05 g/molSarafotoxin B trifluoroacetate salt
CAS:<p>Component of snake venom; part of a family of vasoconstrictor isopeptides</p>Fórmula:C110H159N27O34S5Pureza:Min. 95%Peso molecular:2,563.93 g/molAmyloid β-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H74N10O11SPeso molecular:915.17 g/molBudralazine
CAS:<p>Budralazine is a synthetic vasodilator, which is derived from a series of hydrazine analogs, known for their ability to modulate vascular tone. Its mode of action involves the direct relaxation of vascular smooth muscle. This relaxation leads to a decrease in peripheral vascular resistance and, consequently, a reduction in blood pressure. Intriguingly, Budralazine is thought to selectively target arterioles over veins, making it of particular interest in the study of vascular dynamics and hypertension.</p>Fórmula:C14H16N4Pureza:Min. 95%Peso molecular:240.3 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C111H191N39O29S2Peso molecular:2,600.07 g/molInsulin-Like Growth Factor II (69-84)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H124N20O26Peso molecular:1,817.9 g/molVA-β-MSH, Lipotropin-γ, Proopiomelanocortin - derived
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H188N36O37SPeso molecular:2,831.19 g/molItacitinib
CAS:<p>Itacitinib is a Jak1 inhibitor that is used to treat bowel disease. Itacitinib has been shown to inhibit the growth of probiotic bacteria such as Lactobacillus and Bifidobacterium, which are beneficial for intestinal health. Itacitinib also inhibits the production of inflammatory cytokines, such as TNF-α, IL-6, and IL-8, in vitro in human monocytes. This drug has been shown to reduce the severity of bronchiolitis obliterans (a rare lung disease) in vivo in mice. Itacitinib binds to the cell factor on activated T cells and inhibits its signaling pathway. In addition, it blocks PD-L1 expression on tumor cells, thereby preventing tumor cell proliferation and inducing an M2 phenotype (a type of immune response). Finally, itacitinib inhibits Jak2 V617F activity by binding to this enzyme and causes a decrease in disease activity.</p>Fórmula:C26H23F4N9OPureza:Min. 95%Peso molecular:553.51 g/mol[D-Ala2,DMet5] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H37N5O7SPeso molecular:587.70 g/molAc-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H147N29O24SPeso molecular:2,135.50 g/molBiotin-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C81H126N26O21S2Peso molecular:1,864.2 g/mol4A/4B, 5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H73N11O22S3Peso molecular:1,264.38 g/molProsaptide 769P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C114H194N28O35SPeso molecular:2,548.98 g/molDok-4 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H101N21O18Peso molecular:1,524.72 g/molLys-Bradykinin-Ser-Val-Gln-Val-Ser
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H121N23O20Peso molecular:1,688.96 g/molPancreatic Polypeptide (31-36) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H61N13O8Peso molecular:804 g/molNecrofibrin, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H112N16O25Peso molecular:1,541.73 g/molP60c-src Substrate II, Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H45N6O12PPeso molecular:748.8 g/molRC-160(Vapreotide)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H70N12O9S2Peso molecular:1,131.4 g/mol[Des-Tyr1]-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H122N18O25SPeso molecular:1,695.97 g/molLMP1 (156-164), IAL
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H81N13O14Peso molecular:1,148.34 g/molMLC-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H115N25O17Peso molecular:1,578.85 g/molBrain Derived Acidic Fibroblast Growth Factor (1-11)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H95N15O15Peso molecular:1,290.53 g/molβ III probe
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C87H143N27O28S3Peso molecular:2,111.45 g/mol[Tyr4]-Bombesin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H108N24O19S1Peso molecular:1,669.9 g/molSturgeon F
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H83N13O14SPeso molecular:1,254.48 g/molFmoc-L-cysteic acid disodium
CAS:<p>Please enquire for more information about Fmoc-L-cysteic acid disodium including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H17NO7S•Na2Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:437.38 g/molH-Asp-β-Ala-OH
CAS:<p>Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Cor e Forma:PowderPeso molecular:204.18 g/molFibrinopeptide B
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H93N19O25Peso molecular:1,552.60 g/molMMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H64N14O11Peso molecular:977.1 g/molRG 7388
CAS:<p>Inhibitor of MDM2 E3 ubiquitin-protein ligase and MRP1 transporter</p>Fórmula:C31H29Cl2F2N3O4Pureza:Min. 95%Cor e Forma:White To Light (Or Pale) Yellow SolidPeso molecular:616.48 g/molBoc-Gly-Arg-OH
CAS:<p>Please enquire for more information about Boc-Gly-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H25N5O5Pureza:Min. 95%Peso molecular:331.37 g/molN-α-Benzoyl-L-argininamide
CAS:<p>N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.</p>Fórmula:C13H19N5O2Pureza:Min 98%Cor e Forma:White PowderPeso molecular:277.32 g/molOrexin A (17-33) trifluoroacetate salt
CAS:<p>Orexin A (17-33) trifluoroacetate salt H-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu is a peptide fragment that belongs to the orexin family. It is a potent antagonist of the G protein coupled receptors, which are responsible for mediating the effects of endogenous and exogenous ligands. Orexin A (17-33) trifluoroacetate salt H has been shown to have cytosolic interactions with calcium ions, regulating their concentration in the cytosol. It also affects choline levels and increases intracellular calcium concentrations. The peptide also potentiates responses to cocaine and other drugs that target GPCRs. This drug has been shown to be active against xestospongin, an antibiotic that inhibits protein synthesis</p>Fórmula:C79H125N23O22Pureza:Min. 95%Peso molecular:1,748.98 g/molβ-Casomorphin (1-4) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H34N4O6Peso molecular:522.61 g/molIptacopan
CAS:<p>Iptacopan is an oral, small-molecule therapeutic, which is a complement factor B inhibitor that targets the alternative pathway of the complement system. This pathway is a component of the immune system's innate response and, when dysregulated, can contribute to the pathogenesis of various complement-mediated diseases.</p>Fórmula:C25H30N2O4Pureza:Min. 95%Peso molecular:422.5 g/mol15:0 Lyso PC
CAS:<p>15:0 Lyso PC is a lipid with a fatty acid backbone. It is found in the blood and tissue of mammals, such as humans and cows. 15:0 Lyso PC is produced by the liver, where it plays an important role in cholesterol metabolism. This lipid can be used as a diagnostic marker for chronic kidney disease and heart disease. It also has been shown to have a positive correlation with blood pressure levels. Hippuric acid is another potential diagnostic marker for cirrhosis diagnosis and prognosis.</p>Fórmula:C23H48NO7PPureza:Min. 95%Peso molecular:481.6 g/molKinase Domain of Insulin Receptor (1)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H105N18O25PPeso molecular:1,629.72 g/molAntho-Rwamide I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C31H46N10O7Peso molecular:670.79 g/molDimethylsildenafil
CAS:<p>Please enquire for more information about Dimethylsildenafil including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C23H32N6O4SPureza:Min. 95%Peso molecular:488.6 g/molDesmopressin
CAS:Produto Controlado<p>Desmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.</p>Fórmula:C46H64N14O12S2Pureza:Min. 95%Cor e Forma:PowderPeso molecular:1,069.22 g/molrac Enterolactone -13C3
CAS:<p>rac Enterolactone -13C3 is a stable isotope-labelled lignan, which is a type of compound derived from plant sources. It is biosynthesized through the conversion of dietary lignans by intestinal microbiota. The -13C3 label indicates that three carbon atoms in the compound have been replaced with the carbon-13 isotope, facilitating precise analytical tracking. This product acts as a tracer, allowing scientists to study metabolic pathways and the bioavailability of lignans in biological systems.</p>Fórmula:C18H18O4Pureza:Min. 95%Peso molecular:298.3 g/molDok-5 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C75H114N24O19Peso molecular:1,655.89 g/molHPV-E6-N
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H128N24O25SPeso molecular:1,810.07 g/mol[D-Val22, Phe33] Big Endothelin-1 (16-38), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C122H178N32O33Peso molecular:2,620.97 g/molBig Gastrin-1, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C176H251N43O53SPeso molecular:3,849.30 g/molBRD6688
CAS:<p>BRD6688 is a protein inhibitor that binds to and inhibits the activity of GABA transporters. It is a potent inhibitor of the gaba transporter (GAT) with an IC50 of 0.2 μM. BRD6688 has been shown to inhibit the acetylation of histone proteins, which are important for transcriptional regulation and gene expression. BRD6688 also has a thermodynamic inhibitory constant (Ki) of 1.4 μM and a kinetic inhibitory constant (Ki) of 0.3 μM, indicating that it binds tightly to GATs and does not dissociate easily from it. The Ki values were determined by measuring the inhibition of GAT-mediated chloride transport in cells cultured in vitro. This drug also inhibits antigen presentation in T cells by inhibiting protein synthesis and cell division, as well as histone methylation during mitosis, leading to downregulation of cell-surface antigens on B cells.</p>Fórmula:C16H18N4OPureza:Min. 95%Cor e Forma:PowderPeso molecular:282.34 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C159H267N49O43Pureza:Min. 95%Peso molecular:3,553.13 g/molNeuropeptide Y-Lys(Biotin), human, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C199H300N57O60S2Peso molecular:4,514.98 g/molEMP-1 (Epithelial Membrane Protein)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C94H133N25O26S2Peso molecular:2,093.39 g/molα-Casein (90-95)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/molLeucopyrokinin (LPK)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H66N12O12Peso molecular:931.06 g/molβ-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C39H64N12O19Peso molecular:1,005.01 g/molH-D-Ile-Asp-OH
CAS:<p>Please enquire for more information about H-D-Ile-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C10H18N2O5Pureza:Min. 95%Peso molecular:246.26 g/molGlp-1(7-36), amide acetate
CAS:Produto Controlado<p>Glp-1(7-36), amide acetate is a peptide that is used as a research tool in cell biology and pharmacology. It has been shown to activate the GLP-1 receptor, which can lead to inhibition of food intake and glucose production by pancreatic beta cells. Glp-1(7-36), amide acetate binds to the GLP-1 receptor and inhibits the binding of agonists such as exendin-4. This binding blocks the activation of G proteins, leading to an increase in intracellular calcium levels. The high purity of this product makes it ideal for use in research settings where trace impurities may interfere with results.</p>Fórmula:C149H226N40O45·xC2H4O2Pureza:Min. 95%Peso molecular:3,357.73 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H103N21O13Peso molecular:1,362.66 g/molAc-β-Endorphin, bovine, camel, ovine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C157H252N42O45SPeso molecular:3,479.99 g/molOrn8, Urotensin II, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H85N13O18S2Peso molecular:1,376.60 g/molIL-8ra (9-29)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H150N24O38S2Peso molecular:2,504.71 g/molH-D-Ile-Phe-Lys-pNA trifluoroacetate salt
CAS:<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C27H38N6O5Pureza:Min. 95%Peso molecular:526.63 g/molProstaglandin F2a
CAS:<p>Natural prostaglandin; induces uterine contractions; abortifacient</p>Fórmula:C20H34O5Pureza:Min. 95%Cor e Forma:Colorless PowderPeso molecular:354.48 g/molFmoc-D-Ser(BSi)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H31NO5SiPureza:Min. 95%Peso molecular:441.59 g/molEhrlichia Canis gp19 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp19 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%GAP 26 trifluoroacetate salt
CAS:<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>Fórmula:C70H107N19O19SPureza:Min. 95%Peso molecular:1,550.78 g/molCreatine phosphate monosodium salt hexahydrate
CAS:<p>Phosphate reservoir in muscles, aiding conversion of ADP to ATP</p>Fórmula:C4H10N3O5P·Na·6H2OCor e Forma:PowderPeso molecular:342.19 g/molClopidogrel
CAS:Produto Controlado<p>Methyl (2S)-2-(2-chlorophenyl)-2-(9-thia-4-azabicyclo[4.3.0]nona-7,10-dien-4-yl)acetate, also know as Clopidogrel, is a potent inhibitor of the platelet aggregation. It reduces blood clotting by inhibiting the ADP receptor on the surface of platelets, thereby inhibiting the aggregation and adhesion of platelets. Clopidogrel has been shown to be effective in preventing thrombosis, myocardial infarction (heart attack), and stroke. Clopidogrel inhibits the activity of cytochrome P450 3A4 (CYP3A4) and p2Y 12 receptors. Clopidogrel has been shown to have synergic effects with nonsteroidal anti-inflammatory drugs (NSAIDs). The polymorphic nature of Clopidogrel can be monitored using a liquid chromatography-tandem mass spectrometry (LC-MS/MS) method for quantification in biological samples such as human serum and plasma.</p>Fórmula:C16H16ClNO2SPureza:Min. 95%Cor e Forma:PowderPeso molecular:321.82 g/molAZD5069
CAS:<p>AZD5069 is a small molecule that serves as a potent and selective antagonist of the CXC chemokine receptor 2 (CXCR2). It is derived from synthetic pharmaceutical research efforts aimed at targeting key signaling pathways in inflammatory diseases. This compound functions by inhibiting the CXCR2 receptor, which plays a critical role in the recruitment and activation of neutrophils, a type of white blood cell involved in inflammation and immune responses.</p>Fórmula:C18H22F2N4O5S2Pureza:Min. 95%Peso molecular:476.52 g/molBrucella Abortus Antigen
<p>Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Recombinant Zika Virus NS1 Antigen
<p>Please enquire for more information about Recombinant Zika Virus NS1 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Amyloid β-Protein (25-35) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>Fórmula:C45H81N13O14SPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,060.27 g/molGhrelin-[Cys(AF647)] Human
<p>Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.</p>Pureza:Min. 95%Peso molecular:4,326.9 g/molHuman ACTH(18-39) trifluoroacetate
CAS:<p>Please enquire for more information about Human ACTH(18-39) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C112H165N27O36•(C2HF3O2)xH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS:<p>H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.</p>Fórmula:C44H63N11O13Pureza:Min. 95%Cor e Forma:PowderPeso molecular:954.04 g/molProcollagen Type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH
CAS:<p>Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is a tetrapeptide that is the most abundant component of human skin. It has been shown to have biological properties and can be synthesized in vitro. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH has an absorption maximum at 265 nm, which makes it suitable for use in uv protection creams. It also has a high chemical stability and can be stored for up to two years without degradation. Procollagen type I (212-216) H-Lys-Thr-Thr-Lys-Ser-OH is used as a substrate in cell culture to study protein synthesis and transcription, or polymerase chain reaction, technique. This peptide also inhibits the activity of proteases such as trypsin and chymotrypsin, making</p>Fórmula:C23H45N7O9Pureza:Min. 95%Cor e Forma:White Off-White PowderPeso molecular:563.65 g/molEhrlichia Canis gp19 Antigen, Recombinant
<p>Please enquire for more information about Ehrlichia Canis gp19 Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%(Lys4)-Sarafotoxin C acetate salt
CAS:<p>A component of snake venom, this product contains disulfide bonds between Cys1 and Cys15/Cys3 and Cys11. <br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction.</p>Fórmula:C105H153N27O36S5Pureza:Min. 95%Peso molecular:2,529.83 g/molN-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide
CAS:<p>Please enquire for more information about N-(2-Amino-ethyl)-2-(benzyl-phenyl-amino)-acetamide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H21N3OPureza:Min. 95%Cor e Forma:White PowderPeso molecular:283.37 g/molAmyloid β-Protein (35-25) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (35-25) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C45H81N13O14SPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,060.27 g/molN-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide
CAS:<p>Please enquire for more information about N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H35N3O5Pureza:Min. 95%Peso molecular:409.52 g/molc26 Carnitine-d9
CAS:Produto Controlado<p>C26 Carnitine-d9 is a stable isotopically labeled form of carnitine, which is a quaternary ammonium compound naturally synthesized from amino acids lysine and methionine in the human body. Its isotopic labeling with deuterium enhances its application in various analytical techniques while retaining the biological properties of natural carnitine. The mode of action involves carnitine's essential role in the transport of long-chain fatty acids into the mitochondrial matrix for β-oxidation, facilitating energy production. C26 Carnitine-d9 is used primarily in metabolic research and diagnostics, particularly in studying fatty acid metabolism, assessing metabolic disorders, and quantifying carnitine levels in biological samples through techniques such as mass spectrometry. Its stable isotopic label allows for precise tracking and quantitation, offering insights into metabolic pathways and biochemical assays crucial for understanding metabolic functions and potential dysfunctions.</p>Fórmula:C33H56D9NO4Pureza:Min. 95%Peso molecular:548.93 g/molβ-Casomorphin (1-5) (bovine) trifluoroacetate
CAS:<p>Please enquire for more information about β-Casomorphin (1-5) (bovine) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C30H37N5O7•C2HF3O2Pureza:Min. 95%Peso molecular:693.67 g/molCisatracurium besylate
CAS:<p>nAChRs nicotinic receptor antagonist; neuromuscular-blocking agent</p>Fórmula:C65H82N2O18S2Pureza:Min. 95%Cor e Forma:White PowderPeso molecular:1,243.48 g/molδ-Sleep Inducing Peptide trifluoroacetate salt
CAS:<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>Fórmula:C35H48N10O15Peso molecular:848.81 g/mol(Hyp 3,b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>Fórmula:C49H75N15O12SPureza:Min. 95%Cor e Forma:PowderPeso molecular:1,098.28 g/molCalcipotriol monohydrate
CAS:<p>Calcipotriol is a synthetic vitamin D3 analog that has been shown to be effective in the treatment of bone cancer. It has a film-forming property and is used in pharmaceutical preparations as well as for wastewater treatment. Calcipotriol monohydrate is made by reacting calcipotriol with hydrochloric acid, which produces an ester bond between the hydroxyl group and the carboxylic acid group. The reaction also produces water, methanol, and methyl ethyl ether. Studies have shown that calcipotriol monohydrate has a chemical stability of over 30 days at room temperature, indicating it can be stored for long periods without degradation.</p>Fórmula:C27H40O3·H2OPureza:(%) Min. 96%Cor e Forma:PowderPeso molecular:430.62 g/molAmyloid b-Protein (1-42) (mouse, rat)
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-42) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C199H307N53O59SPureza:Min. 95%Peso molecular:4,417.95 g/molAmyloid β-Protein (10-20)
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is found in the brain. Aβ has been shown to be involved in Alzheimer's disease, Parkinson's disease, and other neurodegenerative diseases. Aβ can be used as a biomarker for these diseases because it accumulates in the brain and blood of patients with these diseases. It is hypothesized that Aβ binds to cell surface proteins, such as choline receptors, which disrupts the function of neurons. This leads to decreased production of acetylcholine and eventual death of neurons. This study sought to identify inhibitors of Aβ aggregation by screening a library of small molecules against Aβ aggregates. The screen identified several potential anticancer compounds that are acidic and reactive. These compounds have been shown to inhibit polymerase chain reaction (PCR) amplification at nanomolar concentrations. In addition, they have been shown to reduce the expression of phosphofructokinase (PFK), an enzyme important in gly</p>Fórmula:C71H99N17O16Pureza:Min. 95%Peso molecular:1,446.65 g/molAbz-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C42H58N12O16Pureza:Min. 95%Peso molecular:986.98 g/mol(Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro18,Asp21)-Amyloid b-Protein (17-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C33H43N5O8Pureza:Min. 95%Peso molecular:637.72 g/mol(Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Lys15)-Amyloid b-Protein (15-21) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H69N9O8Pureza:Min. 95%Peso molecular:852.07 g/mol(Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C51H82N14O18Pureza:Min. 95%Peso molecular:1,179.28 g/molAmyloid β-Protein (1-16) trifluoroacetate salt
CAS:<p>Amyloid beta-Protein (1-16) trifluoroacetate salt is a modified form of amyloid beta protein. It is synthesized by the modification of amino acids with trifluoroacetic acid and can be used to study the pathogenesis of Alzheimer's disease. Amyloid beta-Protein (1-16) trifluoroacetate salt has been shown to bind to β-amyloid, which is thought to be the main component of plaques in Alzheimer's disease. This binding inhibits the formation of β-amyloid aggregates, which are associated with neurotoxicity and neuronal cell death.</p>Fórmula:C84H119N27O28Pureza:Min. 95%Peso molecular:1,955.01 g/molAmyloid Bri Protein (1-34) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C173H273N49O52S2Pureza:Min. 95%Peso molecular:3,935.45 g/molDulaglutide - solution in PBS
CAS:<p>Glucagon-like peptide 1 (GLP-1) receptor agonist</p>Pureza:Min. 95%Chlorpropamide
CAS:<p>Hypoglycemic agent</p>Fórmula:C10H13ClN2O3SPureza:Min. 95%Cor e Forma:White Off-White PowderPeso molecular:276.74 g/molAmyloid β-Protein (1-39) trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid beta-Protein (1-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H286N52O57SPureza:Min. 95%Peso molecular:4,230.68 g/mol
