Glucagon Receptor
Glucagon receptors are GPCRs that mediate the effects of glucagon, a hormone involved in regulating glucose homeostasis by promoting glycogen breakdown and glucose release from the liver. These receptors are critical in the management of blood sugar levels and are of particular interest in the study of diabetes and metabolic disorders. Glucagon receptor antagonists are being explored as potential treatments for hyperglycemia in type 2 diabetes. At CymitQuimica, we offer a variety of high-quality glucagon receptor modulators to support your research in endocrinology, diabetes, and metabolic regulation.
Found 164 products of "Glucagon Receptor"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Crotedumab
CAS:<p>Crotedumab (REGN1193) is a humanized antibody targeting GCGR, which reduces fasting blood glucose and improves glucose tolerance, used in diabetes research.</p>Purity:>95%Color and Shape:LiquidVolagidemab
CAS:<p>Anti-CD34 Antibody is a CHO-expressed humanized monoclonal antibody targeting CD34, which can be used for the study of neurological and cardiovascular diseases.</p>Purity:97.8% (SDS-PAGE); 98% (SEC-HPLC) - 97.8% (SDS-PAGE); 98% (SEC-HPLC)Color and Shape:LiquidGlucagon (1-29), bovine, human, porcine hydrochloride
CAS:<p>Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon increases HNF4α phosphorylation.</p>Formula:C153H225N43O49S·ClHPurity:95.65% - 98.03%Color and Shape:SolidMolecular weight:3519.21Retatrutide sodium salt
<p>Retatrutide sodium salt is a glucagon receptor and glucagon-like peptide-1 receptor agonist for the study of type 2 diabetes mellitus.</p>Purity:99.97%Color and Shape:SoildPF-06882961
CAS:<p>PF-06882961 is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Formula:C31H30FN5O4Purity:98.06% - 99.54%Color and Shape:SolidMolecular weight:555.6Tirzepatide monosodium salt
<p>Tirzepatide sodium salt (LY3298176 sodium salt) is a GIP and GLP-1 receptor agonist with neuroprotective activity and can be used to treat obesity.</p>Formula:C225H347N48O68NaPurity:99.69%Color and Shape:SoildMolecular weight:4835.51Retatrutide
CAS:<p>Retatrutide (LY3437943) is a triple agonist of GCGR, GIPR and GLP-1R that can be used to study obesity.</p>Formula:C221H342N46O68Purity:98.31%Color and Shape:SolidMolecular weight:4732.09Avexitide acetate
CAS:<p>Avexitide acetate (exendin 9-39) is a potent glucagon-like peptide 1 receptor (GLP-1R) antagonist for the study of post-obesity hypoglycemia.</p>Formula:C155H246N40O53SPurity:96.64% - 98.65%Color and Shape:SolidMolecular weight:3549.91(S, R)-LSN 3318839
CAS:<p>(S,R)-LSN 3318839 enhances GLP-1R, shows strong blood sugar lowering in animals, works with sitagliptin.</p>Formula:C26H23Cl2N3O2Purity:99.57%Color and Shape:SoildMolecular weight:480.39GLP-1R Agonist DMB
CAS:<p>GLP-1R Agonist DMB is an agonist of glucagon-like peptide 1 receptor (GLP-1R; KB = 26.3 nM for the recombinant human receptor).</p>Formula:C13H15Cl2N3O2SPurity:99.52%Color and Shape:SolidMolecular weight:348.25GLP-1R Antagonist 1
CAS:<p>GLP-1R Antagonist 1 is an orally active, CNS penetrant and non-competitive glucagon-like peptide 1 receptor (GLP-1R) antagonist (IC50: 650 nM).</p>Formula:C16H11ClF6N4O2Purity:99.84%Color and Shape:SolidMolecular weight:440.73HAEGTFTSD
CAS:<p>HAEGTFTSD is GLP-1's initial segment; GLP-1 (7-36) amide, tied to food intake, stems from preproglucagon in L-cells.</p>Formula:C40H57N11O17Purity:98%Color and Shape:SolidMolecular weight:963.94Tirzepatide
CAS:<p>Tirzepatide (LY-3298176) is a dual glucose-dependent polypeptide (GIP) (EC50=0.042 nM) and glucagon-like peptide-1 (GLP-1) (EC50=0.086 nM) receptor agonist.</p>Formula:C225H348N48O68Purity:99.52% - 99.99%Color and Shape:SolidMolecular weight:4813.45HAEGT
CAS:<p>HAEGT is the first N-terminal 1-5 residues of GLP-1 peptide.</p>Formula:C20H31N7O9Purity:98%Color and Shape:SolidMolecular weight:513.5Glucagon receptor antagonists-1
CAS:<p>Glucagon receptor antagonist -1 is a highly effective glucagon receptor antagonist.</p>Formula:C29H34FNO2Purity:98%Color and Shape:SolidMolecular weight:447.58V-0219 hydrochloride
<p>V-0219 hydrochloride: oral GLP-1R PAM for obesity-linked diabetes study.</p>Formula:C20H26ClF3N4O2Purity:99.97%Color and Shape:SoildMolecular weight:446.89Orforglipron
CAS:<p>Orforglipron (LY3502970; GLP-1 receptor agonist 1) is an orally available glucagon-like peptide (GLP-1) receptor agonist for the study of obesity and type 1</p>Formula:C48H48F2N10O5Purity:99.47% - 99.8%Color and Shape:SolidMolecular weight:882.96GLP-1 moiety from Dulaglutide
<p>GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist.</p>Formula:C149H221N37O49Purity:98%Color and Shape:SolidMolecular weight:3314.62HAEGTFTSD acetate(926018-45-3 free base)
<p>HAEGTFTSD acetate is the first N-terminal 1-9 residues of GLP-1 peptide.The GLP-1 (7-36) amide is a product of the preproglucagon gene, which is secreted from</p>Formula:C42H61N11O19Purity:98%Color and Shape:SolidMolecular weight:1024.01GLP-1 receptor agonist 13
<p>Compound (S)-9, a GLP-1 receptor agonist, exhibits an EC50 of 76 nM for the glucagon GLP-1 receptor [1].</p>Formula:C25H23ClF2N6OColor and Shape:SolidMolecular weight:496.94Albiglutide Fragment
CAS:<p>Albiglutide fragment is a 30-amino-acid sequence of modified human GLP-1 (fragment 7-36).</p>Formula:C148H224N40O45Purity:98%Color and Shape:SolidMolecular weight:3283.66α-Methylprednisolone 21-hemisuccinate sodium salt
CAS:<p>6α-Methylprednisolone 21-hemisuccinate sodium salt (Asmacortone), a water-soluble ester, is used for allergic, cardiac, and hypoxic emergencies.</p>Formula:C26H33NaO8Purity:99.65%Color and Shape:Lyophilized PowderMolecular weight:496.53Cinnamtannin A2
CAS:<p>Cinnamtannin A2, a tetrameric procyanidin, boosts GLP-1, insulin, CRH expression, and has antioxidant, anti-diabetic, nephroprotective properties.</p>Formula:C60H50O24Color and Shape:SolidMolecular weight:1155.02Tirzepatide hydrochloride
<p>Tirzepatide HCl is a dual GIP and GLP-1 receptor agonist.</p>Formula:C225H349N48O68ClPurity:98%Color and Shape:SolidMolecular weight:4849.91Survodutide TFA
<p>Survodutide TFA (BI 456906 TFA) is a GCGR/GLP-1R dual agonist, a peptide compound used in obesity research.</p>Formula:C192H289N47O61·xC2HF3OC2Purity:99.29% - 99.96%Color and Shape:SolidMolecular weight:4231.62 (free base)Secretin (28-54), human TFA
<p>Secretin (28-54), human TFA is a 27-amino acid peptide that works on the human Secretin receptor.</p>Formula:C132H221N44F3O42Purity:98%Color and Shape:SolidMolecular weight:3153.48VU0453379
CAS:<p>VU0453379 is a highly selective and central nervous system penetrant positive allosteric modulator of glucagon-like peptide-1R (EC50: 1.3 μM).</p>Formula:C26H34N4O2Purity:98%Color and Shape:SolidMolecular weight:434.57GLP-1 receptor agonist 4
CAS:<p>GLP-1 receptor agonist 4 targets GLP-1R, EC50 64.5 nM, potential diabetes treatment research.</p>Formula:C51H44Cl2N4O6Purity:98%Color and Shape:SolidMolecular weight:879.82Glucagon (19-29), human
CAS:<p>Glucagon, a 29-amino-acid hormone, is produced by alpha cells in the pancreas' islets of Langerhans.</p>Formula:C61H89N15O18SPurity:98%Color and Shape:SolidMolecular weight:1352.53GLP-1R agonist 19
CAS:<p>GLP-1R agonist 19 (M3190) is a potent, selective GLP-1 receptor agonist that demonstrates excellent plasma and liver microsomal stability, along with low hERG toxicity [1].</p>Formula:C94H136FN21O25Color and Shape:SolidMolecular weight:1979.21Peptide C105Y TFA
<p>Peptide C105Y TFA is a cell-penetrating peptide synthesized based on the amino acid sequence of residues 359-374 of α1-antitrypsin. It enhances the gene expression of DNA nanoparticles.</p>Formula:C97H148N20O23S·xC2HF3O2Orforglipron hemicalcium hydrate
CAS:<p>Orforglipron hemicalcium hydrate (LY3502970 hemicalcium hydrate; GLP-1 receptor agonist 1 hemicalcium hydrate) represents the hemicalcium hydrate form of the calcium salt of Orforglipron, an orally active agonist targeting the Glucagon-like peptide-1 receptor (GLP-1R). This compound has demonstrated efficacy in mitigating type 2 diabetes [1].</p>Formula:C48H48F2N10O5Ca·H2OColor and Shape:SolidMolecular weight:921.02Secretin (33-59), rat TFA
<p>Secretin (33-59), rat (TFA), a 27-aa peptide, stimulates the secretin receptor, increasing pancreas secretion of bicarbonate, enzymes, and K+.</p>Formula:C131H217F3N42O44Color and Shape:SolidMolecular weight:3141.37Ecnoglutide
CAS:<p>Ecnoglutide (XW003) is a glucagon-like peptide 1 (GLP-1) receptor agonist [1] .</p>Formula:C194H304N48O61Color and Shape:SolidMolecular weight:4284.76GLP-1R/GIPR agonist-1
<p>GLP-1R/GIPR agonist-1 is a dual receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulinotropic polypeptide). It mimics the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while suppressing glucagon release, thus lowering blood sugar. This compound is used in research related to metabolic disorders such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH).</p>Formula:C220H342N55O69Molecular weight:4858.49434GLP-1 receptor agonist 9 citrate
<p>GLP-1 receptor agonist 9 citrate is an agonist of GLP-1.</p>Formula:C38H39ClFN3O12Purity:98.76%Color and Shape:SolidMolecular weight:784.18GLP-1 (9-36) amide
CAS:<p>GLP-1 (9-36) amide is an antagonist at the human GLP-1 receptor.</p>Formula:C140H214N36O43Purity:97%Color and Shape:SolidMolecular weight:3089.41GLP-1(28-36)amide TFA
<p>GLP-1(28-36)amide TFA, a nonapeptide cleavage product of GLP-1, shows antioxidant properties with anti-diabetic and cardioprotective effects.</p>Formula:C56H86F3N15O11Color and Shape:SolidMolecular weight:1202.37GLP-1(9-36)amide TFA
<p>GLP-1(9-36)amide TFA, a DPP-4 metabolite of GLP-1(7-36) amide, antagonizes human pancreatic GLP-1 receptor.</p>Formula:C142H215F3N36O45Color and Shape:SolidMolecular weight:3203.43Anti-GLP1R Antibody
<p>Anti-GLP1R Antibody is a human antibody expressed in CHO cells, targeting GLP1R. For isotype controls, refer to Human IgG1 kappa, Isotype Control.</p>Color and Shape:Odour LiquidUtreglutide
CAS:<p>Utreglutide is a potent glucagon-like peptide 1 (GLP-1) receptor agonit [1] .</p>Formula:C191H298N46O58Color and Shape:SolidMolecular weight:4166.67Bay 55-9837 TFA
<p>Bay 55-9837 TFA is a VPAC2 agonist with a 0.65 nM Kd, potential for type 2 diabetes research.</p>Formula:C150H240F3ClN44O44Color and Shape:SolidMolecular weight:3456.22Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide
<p>Biotin-labeled GLP-1-(7-36) amide; a gut peptide that enhances insulin release.</p>Formula:C165H252N44O48SColor and Shape:SolidMolecular weight:3652.1Tirzepatide TFA
<p>Tirzepatide TFA, a GIP and GLP-1 agonist, targets type 2 diabetes treatment.</p>Formula:C227H349F3N48O70Color and Shape:SolidMolecular weight:4927.47Exendin-4 (3-39)
CAS:<p>Exendin-4 (3-39) is a truncated peptide missing first 2 amino acids of Exendin-4, a potent GLP-1r agonist used in diabetes and HPA axis research.</p>Formula:C176H272N46O58SColor and Shape:SolidMolecular weight:3992.44Glucagon-like peptide 1 (1-37), human
CAS:<p>Human GLP-1 (1-37) is a potent GLP-1 receptor agonist without impact on rat food intake or insulin secretion.</p>Formula:C186H275N51O59Purity:98%Color and Shape:SolidMolecular weight:4169.48Secretin (28-54), human
CAS:<p>Secretin (28-54), human, is a 27-amino acid residue peptide with a C-terminal amidation, acting on human secretin receptors.</p>Formula:C130H220N44O40Purity:98%Color and Shape:PowderMolecular weight:3039.46Albenatide
CAS:<p>Albenatide is a modified analog of exendin 4 conjugated to recombinant human albumin.</p>Formula:C26H47N7O9SPurity:98%Color and Shape:SolidMolecular weight:633.76HAEGTFTSDVS
CAS:<p>HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.</p>Formula:C48H71N13O20Purity:98%Color and Shape:SolidMolecular weight:1150.18Pal-Glu(OSu)-OH
CAS:<p>Pal-Glu(OSu)-OH is a Liraglutide side chain, a GLP-1 agonist for type 2 diabetes study.</p>Formula:C25H42N2O7Color and Shape:SolidMolecular weight:482.618TT-OAD2
CAS:<p>TT-OAD2 is a non-peptide agonist of glucagon-like peptide-1 (GLP-1) receptor (EC50: 5 nM), with the potential for diabetes treatment.</p>Formula:C50H49Cl4N3O6Purity:98%Color and Shape:SolidMolecular weight:929.75GLP-2(1-33)(human)
CAS:<p>GLP-2(1-33) (human) is an enteroendocrine hormone which stimulates the growth of the intestinal epithelium.</p>Formula:C165H254N44O55SPurity:98%Color and Shape:SolidMolecular weight:3766.19HAEGTFT
CAS:<p>HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.</p>Formula:C33H47N9O12Purity:98%Color and Shape:SolidMolecular weight:761.78GLP-1(7-36), amide acetate
CAS:<p>GLP-1(7-36), amide acetate is a derivative of GLP-1 peptide , activate the GLP-1 receptor, promote insulin secretion,Type 2 diabetes mellitus and obesity.</p>Formula:C151H230N40O47Purity:99.89%Color and Shape:SolidMolecular weight:3357.68Apraglutide
CAS:<p>Apraglutide (FE 203799 is a synthetic 33-amino acid peptide and long-acting glp-2 analogue.</p>Formula:C172H263N43O52Purity:98%Color and Shape:SolidMolecular weight:3765.25Dulaglutide
CAS:<p>Dulaglutide (LY2189265) is a GLP-1 receptor agonist for studying type 2 diabetes mellitus (T2DM).</p>Color and Shape:SolidTaspoglutide
CAS:<p>Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist(EC50 value of 0.06 nM),and for treatment of type 2 diabetes</p>Formula:C152H232N40O45Purity:98%Color and Shape:SolidMolecular weight:3339.763LSN3160440
CAS:<p>LSN3160440 is a GLP-1R allosteric modulator and PPI stabilizer aiding inactive GLP-1 attachment.</p>Formula:C27H27Cl2N3OColor and Shape:SolidMolecular weight:480.43Des His1, Glu8 Exendin-4
<p>Des His1, Glu8 Exendin-4 is a glucagon-like peptide-1 receptor (GLP1R) antagonist that regulates blood glucose and is used in the study of diabetes and obesity.</p>Formula:C179H277N47O59SPurity:99.92%Color and Shape:SolidMolecular weight:4063.46Secretin, porcine
CAS:<p>Porcine secretin: 27-amino acid peptide for diagnosing pancreatic dysfunction and gastrinoma, stimulates bicarbonate fluid.</p>Formula:C130H220N44O41·xC2H4O2Purity:98%Color and Shape:SolidMolecular weight:N/ATT-OAD2 free base
CAS:<p>TT-OAD2 free base, a non-peptide GLP-1 receptor agonist, can treat diabetes; has an EC50 of 5 nM.</p>Formula:C50H47Cl2N3O6Purity:98%Color and Shape:SolidMolecular weight:856.83{Val1}-Exendin-3/4
<p>{Val1}- exendin-3/4 is the first n-terminal 1-28 residue of exendin-4 peptide.</p>Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3241.7GLP-1R agonist 14
CAS:<p>GLP-1R agonist 14, also known as Compound 14, is a potent agonist of the GLP-1 receptor, demonstrating an EC50 range of 0-20 nM against human GLP-1 [1].</p>Formula:C45H42F2N10O5Color and Shape:SolidMolecular weight:840.88GIP/GLP-1 dual receptor agonist-1
CAS:<p>Compound 4: GIP/GLP-1 agonist for metabolic/fatty liver disease research.</p>Color and Shape:SolidHAEGTFTSDVS acetate
<p>HAEGTFTSDVS acetate is the first N-terminal 1-11 residues of GLP-1 which stimulates insulin secretion from pancreatic β-cells.</p>Formula:C50H75N13O22Purity:97.47%Color and Shape:SolidMolecular weight:1210.2GLP-1R agonist 29
<p>GLP-1R agonist 29 (Compound 20) is a GLP-1R agonist that induces hGLP-1R-mediated cAMP stimulation with an EC50 of 0.018 nM. It exhibits favorable pharmacokinetic properties and shows good in vivo exposure, with an AUC0-∞,sc of 77688 ng·h/mL.</p>Color and Shape:Odour SolidExendin-3/4 (59-86)
<p>Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.</p>Formula:NAPurity:98%Color and Shape:SolidMolecular weight:3055.49GLP-1(7-37)
CAS:<p>GLP-1 (7-37) is a truncated, bioactive form of GLP-1 that is the product of proglucagon processing in intestinal endocrine L cells.</p>Formula:C151H228N40O47Purity:98%Color and Shape:SolidMolecular weight:3355.67Mazdutide acetate(2259884-03-0 free base)
<p>Mazdutide acetate is a potent (GLP-1R and GCGR agonist that stimulates insulin secretion from mouse pancreatic islets , which can be used to study obesity.</p>Purity:98.41%Color and Shape:Odour SolidBay 55-9837
CAS:<p>Selective VPAC2 agonist; EC50: 0.4 nM (VPAC2), 100 nM (VPAC1), >1000 nM (PAC1). Enhances insulin secretion, reduces HIV-1 replication.</p>Formula:C167H270N52O46Purity:98%Color and Shape:SolidMolecular weight:3742.29Semaglutide TFA
<p>Semaglutide TFA is a glucagon-like peptide-1 congener that induces weight loss, lowers blood glucose levels and reduces cardiovascular risk in diabetic patients</p>Formula:C189H290F3N45O61Purity:99.69%Color and Shape:SolidMolecular weight:4225.6482Survodutide
CAS:<p>Survodutide (BI 456906) is a dual agonist of glucagon and glucagon-like peptide 1 (GLP-1) receptor (GLP Receptor) that reduces body weight in HbA1c16 diabetes.</p>Formula:C192H289N47O61Purity:99.83%Color and Shape:SolidMolecular weight:4229.0957VU0453379 hydrochloride
<p>VU0453379 hydrochloride: selective CNS-penetrant GLP-1R PAM, EC50 1.3 μM.</p>Formula:C26H35ClN4O2Color and Shape:SolidMolecular weight:471.033-Deoxyglucosone
CAS:<p>3-Deoxyglucosone(3-Deoxy-D-glucosone) is synthesized by the intermediate pathway of the melad and polyol reactions.3-Deoxyglucosone reacts rapidly with protein</p>Formula:C6H10O5Purity:95%Color and Shape:SolidMolecular weight:162.14Sorbinicate
CAS:<p>Sorbinicate is an antihypercholesterolaemic and vasodilating nicotinic acid ester.</p>Formula:C42H32N6O12Purity:98%Color and Shape:SolidMolecular weight:812.74Albiglutide fragment TFA
<p>Albiglutide fragment (GLP-1 (7-36) analog) TFA represents a biologically active segment of Albiglutide, resistant to DPP-4 degradation due to its structure as a</p>Formula:C148H224N40O45·xC2HF3O2Color and Shape:Solid(R)-V-0219 hydrochloride
<p>(R)-V-0219 hydrochloride: Oral GLP-1R PAM, enantiomer of V-0219, triggers Ca2+ flux in hGLP-1R HEK cells.</p>Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89Maridebart
CAS:<p>Maridebart is a humanized IgG1-kappa monoclonal antibody that targets the GIPR (gastric inhibitory polypeptide receptor) [1].</p>Color and Shape:LiquidOxyntomodulin
CAS:<p>GLP-1 analog modulates appetite, boosts metabolism, and curbs gastric acid. Increases cAMP, mildly stimulates glucagon receptor.</p>Formula:C192H295N59O60SPurity:98%Color and Shape:SolidMolecular weight:4421.86GLP-1 receptor agonist 8
CAS:<p>GLP-1 receptor agonist 8, potent for diabetes and obesity research, may also study NAFLD.</p>Formula:C34H36ClFN6O4Color and Shape:SolidMolecular weight:647.14[Des-His1,Glu9]-Glucagon amide
CAS:<p>Glucagon blocker with pA2 of 7.2; no agonist effect. Boosts insulin; prevents glucagon-driven hyperglycemia in rabbits and diabetic rats.</p>Formula:C148H221N41O47SPurity:98%Color and Shape:SolidMolecular weight:3358.68GLP-1R agonist 27
<p>GLP-1R agonist 27 (compound 21) is a potent and orally active GLP-1R agonist. It enhances the accumulation of cyclic adenosine monophosphate (cAMP), reduces blood glucose levels, and decreases food intake. GLP-1R agonist 27 shows potential for research in obesity and type 2 diabetes mellitus (T2DM).</p>Formula:C32H33N5O4SeColor and Shape:SolidMolecular weight:630.6(S)-V-0219 hydrochloride
<p>(S)-V-0219 hydrochloride, a GLP-1R PAM, triggers calcium in hGLP-1R HEK cells, lowers glucose in mice, and reduces fasting hunger.</p>Formula:C20H26ClF3N4O2Color and Shape:SolidMolecular weight:446.89GLP-1R agonist 15
CAS:<p>GLP-1R agonist 15 (Compound 101) is a GLP-1 receptor agonist [1] .</p>Formula:C46H47FN8O7SColor and Shape:SolidMolecular weight:874.98Gulgafafusp alfa
CAS:<p>Gulgafafusp alfa is a human IgG2κ monoclonal antibody that selectively binds to the glucagon-like peptide 1 receptor (GLP1R) [1].</p>Color and Shape:LiquidAnti-GLP-1R Antibody
<p>Anti-GLP-1R Antibody is an anti-GLP-1R antibody that can be used for immunohistochemistry of paraffin sections.</p>Purity:98.3% (SDS-PAGE); 97.2% (SEC-HPLC) - 98.3% (SDS-PAGE); 97.2% (SEC-HPLC)Color and Shape:Odour LiquidSPN009
<p>SPN009 (Sequence 3) is a GLP-1 receptor (GLP-1 Receptor) agonist, with an EC50 of 2.84 nM, and improves type 2 diabetes in DB/DB mouse models.</p>Formula:C191H299N45O59Molecular weight:4167.17798Glucagon-like peptide 1 (1-37), human TFA
<p>Human Glucagon-like peptide 1 (1-37) TFA is a potent GLP-1 receptor agonist derived from proglucagon.</p>Formula:C188H276N51F3O61Purity:98%Color and Shape:SolidMolecular weight:4283.5GLP-1R agonist 20
<p>GLP-1R agonist 20 (Compound I-132) is an agonist of the glucagon-like peptide-1 receptor (GLP-1 receptor), with an EC50 value of 0.0162 nM.</p>Formula:C31H30Cl2F2N4O5Molecular weight:646.15613GLP-1R agonist 16
CAS:<p>Compound 115a, a GLP-1R agonist, effectively activates the GLP-1 receptor with an EC50 of 0.15 nM [1].</p>Formula:C50H58FN10O6PColor and Shape:SolidMolecular weight:945.03GLP-1R agonist 4
CAS:<p>GLP-1R agonist 4, potentially for diabetes research, is a potent GLP-1R stimulator linked to hypoglycemia.</p>Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05SAR441255
<p>SAR441255 is a potent unimolecular peptide that acts as a GLP-1/GIP/GCG receptor triagonist, demonstrating balanced activation across all three target receptors</p>Color and Shape:Odour SolidFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Color and Shape:SolidMolecular weight:3692.15Dapiglutide
CAS:<p>Dapiglutide (ZP7570) is a long-acting GLP-1R & GLP-2R dual agonist for SBS research.</p>Color and Shape:SolidGRPP (human)
CAS:<p>GRPP (human), a 30-amino-acid peptide derived from Gcg, modestly elevates plasma insulin levels while reducing plasma glucagon concentrations.</p>Formula:C136H215N41O58SColor and Shape:SolidMolecular weight:3384.47Glucagon (1-29), bovine, human, porcine
CAS:<p>Corynoxine B (Cory B) is a naturally occurring alkaloid isolated from Uncaria rhynchophylla (Miq. ) and is an autophagy inducer.</p>Formula:C153H225N43O49SPurity:99.56% - 99.56%Color and Shape:SolidMolecular weight:3482.75GLP-1 receptor agonist 7
CAS:<p>GLP-1 receptor agonist 7, potential for diabetes research, from patent WO2021219019A1.</p>Formula:C31H30ClFN4O5Color and Shape:SolidMolecular weight:593.05GLP-1 receptor agonist 2
CAS:<p>GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Formula:C30H31ClFN5O4Color and Shape:SolidMolecular weight:580.05V-0219
CAS:<p>V-0219 is a positive allosteric modulator of GLP-1 and can be used in studies about obesity-associated diabetes.</p>Formula:C20H25F3N4O2Purity:99.91%Color and Shape:SoildMolecular weight:410.43GLP-1R modulator C16
CAS:<p>GLP-1R modulator C16 is a variable modulator that significantly increases the binding affinity of GLP-4.</p>Formula:C21H26ClFN2O3Purity:99.6% - >99.99%Color and Shape:SolidMolecular weight:408.89Anti-GCGR Antibody (7J909)
<p>Anti-GCGR Antibody (7J909) is an antibody targeting GCGR. Anti-GCGR Antibody (7J909) can be used in ELISA.</p>Color and Shape:Odour LiquidSCO-267
CAS:<p>SCO-267 is a full agonist of GPR40/FFAR1， stimulating insulin secretion and GLP-1 release in diabetic rats, improving glucose tolerance,type 2 diabetes.</p>Formula:C36H46N4O5Purity:99.89%Color and Shape:SolidMolecular weight:614.77GLP-1R modulator C5
CAS:<p>GLP-1R modulator C5 is a GLP-1R modulator that enhances GLP-1 binding to GLP-1R via transmembrane sites and can be used in the study of type II diabetes.</p>Formula:C24H21NO3Purity:99.59%Color and Shape:SolidMolecular weight:371.43Liraglutide
CAS:<p>Liraglutide (Liraglutida) is a synthetic analog of GLP-1, an agonist of the GLP-1 receptor. Liraglutide is an antidiabetic agent. Cost effective and quality assured.</p>Formula:C172H265N43O51Purity:97.65% - 99.04%Color and Shape:SolidMolecular weight:3751.25PF-06882961 Tris
CAS:<p>PF-06882961 Tris (UNII-2HJV78O0SS) is an orally bioavailable glucagon-like peptide-1 receptor (GLP-1R) agonist.</p>Formula:C35H41FN6O7Purity:98.74% - 99.79%Color and Shape:SolidMolecular weight:676.7GRA Ex-25
CAS:<p>GRA Ex-25 (GRA-Ex-25) is an inhibitor of glucagon receptor.</p>Formula:C29H36F3N3O5Purity:98.2% - 98.88%Color and Shape:SolidMolecular weight:563.61Shanzhiside methyl ester
CAS:<p>Shanzhiside methylester soothes neuropathic pain by triggering spinal GLP-1 receptors, boosting microglial β-endorphin through p38 MAPK.</p>Formula:C17H26O11Purity:98.998% - 99.32%Color and Shape:SolidMolecular weight:406.38Lixisenatide acetate (320367-13-3 free base)
CAS:<p>Lixisenatide acetate is a receptor agonist similar to glucagon-like peptide-1 (glp-1) for the treatment of type 2 diabetes mellitus (T2DM).</p>Formula:C215H347N61O65S·6C2H4O2Purity:98% - 99.9%Color and Shape:SolidMolecular weight:5218.88BETP
CAS:<p>BETP is an agonist of GLP-1 receptor (EC50s: 0.66 and 0.755 μM for human and rat GLP-1 receptor).</p>Formula:C20H17F3N2O2SPurity:98.51%Color and Shape:SolidMolecular weight:406.42HAEGTFTSDVSSYLE
<p>HAEGTFTSDVSSYLE is a peptide. GLP-I analog contains the sequence.</p>Formula:C71H103N17O28Purity:>99.99%Color and Shape:SolidMolecular weight:1642.71GLP-1(7-36), amide
CAS:<p>GLP-1 secretion by human enteroendocrine NCI-H716 cells is augmented in a dose-dependent manner by the addition of CPE.Cost-effective and quality-assured.</p>Formula:C149H226N40O45Purity:99.85%Color and Shape:White PowderMolecular weight:3297.63Exendin-4
CAS:<p>Exenatide: GLP-1 receptor agonist, 39-amino acid, longer half-life (2.4 hrs), IC50 of 3.22 nM.</p>Formula:C184H282N50O60SPurity:97.71% - 99.78%Color and Shape:SolidMolecular weight:4186.57Semaglutide
CAS:<p>Semaglutide is a glucagon-like peptide 1 receptor (GLP-1R) agonist(EC50 of 6.2 pM in a reporter assay using BHK cells expressing the human receptor).</p>Formula:C187H291N45O59Purity:96.92% - 99.78%Color and Shape:SolidMolecular weight:4114Exendin-4 acetate
CAS:<p>Exendin-4 acetate is a 39 amino acid peptide.Exendin-4 acetate is a long-acting GLP-1 receptor agonist(IC50 = 3.22 nM).</p>Formula:C186H286N50O62SPurity:98.48% - 99.78%Color and Shape:SolidMolecular weight:4247Oxyntomodulin acetate
<p>Oxyntomodulin acetate, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist[1].</p>Purity:99.24%Color and Shape:LiquidMolecular weight:N/ABay 55-9837 acetate
<p>Bay 55-9837 acetate is a potent and highly selective VPAC2 agonist(Kd = 0.65 nM) and can be used in type 2 diabetes studies.</p>Purity:98.27%Color and Shape:LiquidMolecular weight:N/ASecretin (33-59), rat
CAS:<p>Secretin (33-59), rat (Secretin (rat)) is a classical hormone in the gastrointestinal system and a neuropeptide.</p>Formula:C129H216N42O42Purity:98.12%Color and Shape:SolidMolecular weight:3027.35Glucagon (19-29), human acetate
<p>Glucagon (19-29), human acetate a COOH-terminal fragment processed from glucagon, is a potent and efficient inhibitor of insulin secretion.</p>Formula:C63H93N15O20SPurity:98.11%Color and Shape:SolidMolecular weight:1412.57HAEGTFT acetate(926018-95-3 free base)
<p>HAEGTFT acetate is the first N-terminal 1-7 residues of GLP-1 peptide.</p>Formula:C35H51N9O14Purity:>99.99%Color and Shape:SolidMolecular weight:821.84Tirzepatide Acetate(2023788-19-2 free base)
<p>Tirzepatide (LY3298176) Acetate (2023788-19-2 free base) is a new molecule that can control blood glucose levels.Cost-effective and quality-assured.</p>Formula:C227H352N48O70Purity:97.3% - 98.05%Color and Shape:SolidMolecular weight:4873.5Albiglutide TFA (782500-75-8 free base)
<p>Albiglutide TFA (782500-75-8 free base) (Albiglutide TFA) is a long acting GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus (T2DM).</p>Formula:C150H225F3N40O47Purity:>99.99%Color and Shape:SolidMolecular weight:3397.63Teduglutide acetate
<p>Teduglutide acetate, a GLP-2 analogue, maximizes small intestinal mucosal hypertrophy.</p>Formula:C166H256N44O56SPurity:97.39%Color and Shape:SoildMolecular weight:3812.13ML-SI3
CAS:<p>CCG-143140 is a GLP-1 receptor inverse agonists.</p>Formula:C23H31N3O3SPurity:99.75%Color and Shape:SolidMolecular weight:429.58Exenatide
CAS:<p>Exenatide (Extendin-4) is a glucagon-like protein-1 (GLP-1) receptor agonist.</p>Formula:C186H286N50O62SPurity:99.42%Color and Shape:SolidMolecular weight:4247Glucagon-like peptide 1 (1-37), human acetate
<p>Glucagon-like peptide 1 (1-37), human acetate is a highly potent the GLP-1 receptor agonist.</p>Purity:98%Color and Shape:LiquidMolecular weight:N/ACotadutide acetate
<p>Cotadutide acetate is a potent GLP-1 and glucagon receptor dual agonist with EC50s of 6.9 pM and 10.2 pM.</p>Formula:C169H256N42O57Purity:98.28%Color and Shape:SolidMolecular weight:3788.14GLP-1(7-37) acetate(106612-94-6 free base)
CAS:<p>Glp-1(7-37) acetate is an intestinal insulin hormone that enhances glucose-induced insulin secretion.</p>Formula:C151H228N40O47Purity:98.89%Color and Shape:SolidMolecular weight:3355.67Avexitide
CAS:<p>Avexitide (Exendin-3 (9-39) amide) (Exendin (9-39)) is a specific and competitive antagonist of glucagon-like peptide-1 (GLP-1) receptor.</p>Formula:C149H234N40O47SPurity:98% - 99.65%Color and Shape:SolidMolecular weight:3369.76GLP-1 receptor agonist 9
CAS:<p>1H-Benzimidazole-6-carboxylic acid is a GLP-1 receptor agonist.</p>Formula:C32H31ClFN3O5Purity:98%Color and Shape:SolidMolecular weight:592.06PF-06291874
CAS:<p>PF-06291874 (Glucagon receptor antagonists-4) (Glucagon receptor antagonists-4) is a highly effective and orally active antagonist of the glucagon receptor.</p>Formula:C26H28F3N3O4Purity:99.12% - 99.27%Color and Shape:SolidMolecular weight:503.51NNC-0640
CAS:<p>NNC-0640 is a negative allosteric modulator of Human Glucagon Receptor with an IC50 of 69.2 nM.</p>Formula:C29H31N7O4SPurity:97.04%Color and Shape:SolidMolecular weight:573.67Glucagon receptor antagonists-5
CAS:<p>Oral indazole-based glucagon antagonist, Ki: 32 nM, may treat type 2 diabetes.</p>Formula:C30H29ClF3N3O3Purity:98%Color and Shape:SolidMolecular weight:572.02BAY-27-9955
CAS:<p>BAY-27-9955 is a glucagon receptor antagonist.</p>Formula:C23H31FOColor and Shape:SolidMolecular weight:342.49(R)-V-0219
<p>(R)-V-0219: GLP-1R PAM, orally active, triggers Ca++ flux in HEK-hGLP-1R cells.</p>Formula:C20H25F3N4O2Color and Shape:SolidMolecular weight:410.43GLP-1R agonist 1
CAS:<p>GLP-1R agonist 1, an imidazole derivative and potent GLP-1R activator, may aid diabetes research.</p>Formula:C32H29ClFN3O5Color and Shape:SolidMolecular weight:590.04Glucagon receptor antagonists-2
CAS:<p>Glucagon receptor antagonist -2 is a highly effective glucagon receptor antagonist.</p>Formula:C22H30FNO2Purity:98%Color and Shape:SolidMolecular weight:359.48MS012
CAS:<p>MS012 is a Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase (Kd = 46 ± 15 nM).</p>Formula:C22H35N5O2Color and Shape:SolidMolecular weight:401.55(S)-V-0219
<p>(S)-V-0219: oral, GLP-1R PAM, boosts calcium in hGLP-1R HEK cells, lowers glucose, curbs hunger in mice.</p>Formula:C20H25F3N4O2Color and Shape:SolidMolecular weight:410.43GCGR antagonist 2
CAS:<p>Orally active GCGR antagonist 2, a furan-2-carbohydrazide, binds hGluR at 2.3 nM. Blocks glucagon, inhibits rat receptor at 0.43 nM.</p>Formula:C28H26N4O2Color and Shape:SolidMolecular weight:450.53NNC 92-1687
CAS:<p>NNC 92-1687 is a selective glucagon receptor antagonist that can be used to study type 2 diabetes.</p>Formula:C15H12N2O3SPurity:98.70% - 99.70%Color and Shape:SolidMolecular weight:300.33L-168049
CAS:<p>L-168049: Human glucagon receptor antagonist, IC50 - 3.7 nM human, 63 nM murine, 60 nM canine.</p>Formula:C24H20BrClN2OPurity:>99.99%Color and Shape:SolidMolecular weight:467.79GLP-1R agonist 9
CAS:<p>GLP-1R agonist 9 acts as a GLP-1R agonist, demonstrating efficacy with EC50 values of 1.1 nM and 11 nM against CHO GLP-1R Clone H6 and Clone C6, respectively.</p>Formula:C32H30ClF2N3O5Color and Shape:SolidMolecular weight:610.05GLP-1R agonist 17
CAS:<p>GLP-1R agonist 17 excels in stimulating GLP-1 receptors, useful for cardiovascular metabolic disease research.</p>Formula:C28H26ClFN4O4SColor and Shape:SolidMolecular weight:569.05Glucagon receptor antagonists-3
CAS:<p>Glucagon receptor antagonist -3 is a highly effective glucagon receptor antagonist.</p>Formula:C22H30FNO2Purity:98%Color and Shape:SolidMolecular weight:359.48GLP-1 receptor agonist 3
CAS:<p>GLP-1 receptor agonist 3 is a GLP-1 receptor agonist,Example 4A-1, has EC50s of 1.1 nM and 13 nM in Clone H6 and Clone C6 cell lines assay, respectively.</p>Formula:C31H30FN5O4Purity:98%Color and Shape:SolidMolecular weight:555.6GLP-1R agonist 12
CAS:<p>GLP-1R agonist 12 (Compound 123) 是一种 GLP-1R 激动剂，能够用于研究糖尿病。</p>Formula:C34H36N6O4Color and Shape:SolidMolecular weight:592.69LGD-6972 sodium
CAS:<p>LGD-6972 sodium is a glucagon receptor antagonist.</p>Formula:C43H46N2NaO5SPurity:98%Color and Shape:SolidMolecular weight:725.9Antitumor agent-101
CAS:<p>Antitumor agent-101 is a selective, covalent inhibitor targeting lysine methyltransferases G9a/GLP, demonstrating IC50 values of 8.5 nM for G9a and 5.5 nM for</p>Formula:C26H38N6O3Purity:98%Color and Shape:SolidMolecular weight:482.62MK 0893
CAS:<p>MK 0893 is a potent and selective Glucagon Receptor (GR) antagonist competitive, reversible cAMP activity, which attenuates blood glucose elevation.</p>Formula:C32H27Cl2N3O4Purity:98.79%Color and Shape:SolidMolecular weight:588.48MK3577
CAS:<p>MK3577 is a glucagon receptor antagonist.</p>Formula:C30H30ClFN2O3Color and Shape:SolidMolecular weight:521.02GLP-1R agonist 3
CAS:<p>GLP-1R agonist 3 is a GLP-1R agonist, an imidazole derivative.GLP-1R agonist 3 can be used to study diabetes and obesity.</p>Formula:C31H28FN5O4Purity:97.19%Color and Shape:SolidMolecular weight:553.58GLP-1R agonist 10
CAS:<p>GLP-1R agonist 10 is a GLP-1 agonist (EC50: 0.051 nM).</p>Formula:C29H29ClFN5O4Color and Shape:SolidMolecular weight:566.02LGD-6972
CAS:<p>LGD-6972 is an antagonist of glucagon receptor.</p>Formula:C43H46N2O5SPurity:98.8% - 99.62%Color and Shape:SolidMolecular weight:702.9Lotiglipron
CAS:<p>Lotiglipron (PF-07081532) is a GLP-1R agonist that lowers blood glucose and may be used in the study of type 2 diabetes mellitus (T2DM) and excess obesity.</p>Formula:C31H31ClN4O5Purity:98.3%Color and Shape:SolidMolecular weight:575.05Adomeglivant
CAS:<p>Adomeglivant (LY2409021) is a potent and selective glucagon receptor antagonist. Which is used in clinical trial for type 2 diabetes mellitus.</p>Formula:C32H36F3NO4Purity:99.91%Color and Shape:SolidMolecular weight:555.63PF-06372222
CAS:<p>PF-06372222: a small-molecule that modulates GCGR and antagonizes GLP-1R, affecting insulin and glucagon.</p>Formula:C26H28F3N5O3Purity:98%Color and Shape:SolidMolecular weight:515.53GLP-1 receptor agonist 11
CAS:<p>GLP-1 Receptor Agonist 11 (compound 3) acts as an effective agonist for the GLP Receptor, finding use in research related to conditions like diabetes and non-alc. fatty liver disease [1].</p>Formula:C31H31ClFN3O4Color and Shape:SolidMolecular weight:564.05GLP-1 receptor agonist 16
CAS:<p>GLP-1 receptoragonist 16 (Example 53) is a GLP-1 agonist applicable for research in diabetes, obesity, or diseases related to non-alcoholic steatohepatitis.</p>Formula:C33H31ClFN3O4Color and Shape:SolidMolecular weight:588.068GLP-1 receptor agonist 15
CAS:<p>GLP-1 receptor agonist 15 (Example 4) is a GLP receptor agonist with an EC50 of 0.74 nM. It exhibits an IC50 of 10.1 μM against the hERG potassium ion channel. This compound is applicable for research in the diabetes field.</p>Formula:C32H31ClFN3O5Color and Shape:SolidMolecular weight:592.057SCH-900822
CAS:<p>SCH-900822 is a potent and selective glucagon receptor antagonist.</p>Formula:C34H43Cl2N7O2Color and Shape:SolidMolecular weight:652.66GLP-1R agonist 8
CAS:<p>GLP-1R agonist 8 is a potent agonist of GLP-1R (EC50 < 2 nM).</p>Formula:C33H32N4O5Color and Shape:SolidMolecular weight:564.63DS79932728
CAS:<p>DS79932728 is an orally active inhibitor of G9a and GLP, with IC50 values of 12.6 nM and 75.7 nM, respectively. It induces the production of γ-globin, thereby increasing fetal hemoglobin (HbF) levels. In cynomolgus monkey models, DS79932728 enhances the proportion of F-reticulocytes (F-rets) and shows good oral absorption characteristics.</p>Formula:C19H25N3OColor and Shape:SolidMolecular weight:311.421DA-302168S
CAS:<p>DA-302168S is an orally active, selective GLP-1R agonist with an EC50 value of 1.32 nM. It promotes insulin secretion and has a hypoglycemic effect. Additionally, DA-302168S reduces food intake. It primarily activates GLP-1R in humans and monkeys, with minimal effect on GLP-1R in rats, mice, and dogs. DA-302168S can be used for research in type 2 diabetes and obesity.</p>Formula:C33H24ClF2N3O5Color and Shape:SolidMolecular weight:616.011LSN3318839
CAS:<p>LSN3318839 is a potent and orally available glucagon-like peptide-1 receptor (GLP-1R) modulator.LSN3318839 enhances GLP-1R G-protein-coupled signaling and can</p>Formula:C26H23Cl2N3O2Purity:99.21%Color and Shape:SolidMolecular weight:480.39
![[Des-His1,Glu9]-Glucagon amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2033.webp&w=3840&q=75)
