Organic Halides

<p>Please enquire for more information about Methyl 5-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>8-Bromo-1-octanol is a fluorescent compound that has been shown to be resistant to cancer. It can be used as a probe for the detection of malonic acid in urine samples, which are an indicator of oxidative stress. 8-Bromo-1-octanol is stable in the presence of alcohol groups, and can be used to prepare samples for population growth studies. This chemical has also been used to study the growth of bacteria such as Pseudomonas aeruginosa and Escherichia coli. 8-Bromo-1-octanol emits light at a wavelength of 490 nm when exposed to ultraviolet radiation, which makes it useful for detecting chlorine atoms in water samples. The product research involving this chemical includes its effects on k562 cells and P. aeruginosa. Studies have also been done on its hydroxyl group and fatty acids and fatty acid esters, which are found in animal fat and vegetable oils.</p>

<p>Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is a chemical compound that belongs to the group of apoptosis proteins. It has been shown to have anti-inflammatory and neuroprotective effects in primary cells, as well as to induce apoptosis in HL60 cells. Ac-Leu-Glu-His-Asp-aldehyde (pseudo acid) trifluoroacetate salt is also able to inhibit the activation of the caspase pathway by preventing the release of cytochrome c from mitochondria and decreasing the mitochondrial membrane potential. The protein may be used as an agent for skin cancer treatment.</p>

<p>Please enquire for more information about (Asn670,Leu671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Biotinyl-LL-37 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-(4-Chlorothiophen-2-yl)ethanone is an oxychloride that belongs to the family of thiourea derivatives. It is synthesized by reacting phosphorus oxychloride with 2,3-dichloroacetophenone in a solvent such as dioxane or acetonitrile. The final product is purified by means of vacuum distillation and recrystallization from diethyl ether, hexane, and chlorinated hydrocarbons.</p>

<p>2-Methyl-6-(trifluoromethyl)aniline is a colorless, oily liquid with a sulfurous odor. It is soluble in water and alcohol. The reaction rate of 2-methyl-6-(trifluoromethyl)aniline with sulfoxides is faster than that of benzyl anilines, but slower than that of anilino derivatives. The addition of hydrophobic groups to the 2-methyl-6-(trifluoromethyl)aniline molecule increases the reaction rate. 2-Methyl-6-(trifluoromethyl)aniline can be used as an anesthetic agent because it is a potent inhibitor of nerve conduction in sciatic nerves. It also has been shown to be effective in desulfurizing propylene, which is important for the production of polypropylene plastics and synthetic rubber. 2-Methyl-6-(triflu</p>

<p>2-(3,4-Dichlorophenyl)ethanol is a high quality reagent for the synthesis of complex compounds, useful as an intermediate in organic synthesis and as a building block for speciality chemicals. This chemical is also used as a research chemical in the synthesis of versatile building blocks. It can be used as a reaction component in various reactions such as Suzuki coupling, Negishi coupling, Heck reaction, and Sonogashira coupling.</p>

<p>Ethyl 2-fluoroacetoacetate is a phosphorus oxychloride synthon that can be used to synthesize fluorinated compounds. It has been shown to react with a carbonyl group, like tyrosine, in the presence of an organocatalyst to form a tetrafluoroborate ester. The reaction mechanism of this compound is intramolecular hydrogen transfer from the phosphite oxygen atom to the electrophilic carbon atom. Ethyl 2-fluoroacetoacetate has been shown to react with alkyl halides and hydroxyl groups in the presence of base, forming enantiomeric alcohols. This compound has also been shown to have optical properties that are stable at room temperature and pressure, including infrared absorption maxima at 1740 cm-1 and 1775 cm-1 as well as ultraviolet absorption maxima at 225 nm and 254 nm.</p>

<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>8-Quinolinesulfonyl chloride (8QSC) is a quinoline derivative that has been shown to have anticancer activity. 8QSC binds to the receptor site of cells and inhibits the production of amines, which are important for cell growth and proliferation. It also binds to hydrogen bonds, which may be involved in the cytotoxicity observed in pancreatic cancer cells. 8QSC shows significant cytotoxicity against Panc-1 cells, but not against NIH 3T3 cells. This may be due to its ability to form supramolecular aggregates with copper ions and quinoline derivatives.</p>

<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Trifluoromethyl)phenylacetic acid is an isoquinoline alkaloid that has been found to have anti-inflammatory properties. It was shown to inhibit TNF-α production in mice with colitis, reducing the severity of the disease. 3-(Trifluoromethyl)phenylacetic acid can be administered orally, and it is metabolized reductively by dihydroisoquinoline reductase enzymes. The drug's pharmacokinetics are not well understood, but it is thought to be a substrate for CYP3A4 and P-glycoprotein. 3-(Trifluoromethyl)phenylacetic acid has been studied as a potential antiviral agent and systemic inflammatory response inhibitor.</p>

<p>2,3-Dichloroanisole is a volatile organic compound that has been shown to be an attractant for termites. It is used as a pesticide and agrochemical. 2,3-Dichloroanisole is used as an insecticide against termites and other pests in agriculture. This chemical has been shown to inhibit the sodium channel of the nerve cell membrane, which leads to paralysis of insects. The mechanism of action for this compound is not well understood but it has been suggested that it may act by blocking the reorientation of the sodium ion channels. 2,3-Dichloroanisole can also be used as a metal salt in some thermodynamic reactions.</p>

<p>Please enquire for more information about 5-bromo-2-(trifluoromethyl)benzoic Acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22,Asn23)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (7-Diethylaminocoumarin-3-yl)carbonyl-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-(Piperidin-4-yl)benzoic acid hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ChloroformamidineHydrochloride is an inorganic acid that has a nitrogen atom and a chlorine atom. It is a polymer that is used in the film-forming industry. ChloroformamidineHydrochloride has been shown to be toxicological studies, with tests involving the film forming properties of this molecule. It also has biological properties and can target enzymes such as toll-like receptors and streptococcus faecalis, which are present on the surface of cells. ChloroformamidineHydrochloride can be reacted with creatine to form a molecule called thymidylate, which is needed for DNA synthesis and repair.</p>

<p>H-Gly-Gly-AMC is a fluorescent substrate for the detection of protease activity. It can be used in a homogeneous assay to measure the protease activity of cells. The assay provides an accurate measurement of protease activity and the ability to normalize data to account for differences in cell number and protein content. H-Gly-Gly-AMC hydrochloride salt (HGG) is also a fluorogenic substrate for the determination of cell death or damage, which can be measured using aminoluciferin. This assay is based on the release of aminoluciferin from lysed cells, which fluoresces in proportion to the amount released.</p>

<p>Bis(cyclopentadienyl)titanium (IV) dichloride is a cationic polymerization catalyst that has been used to produce polyolefins with high molecular weights. It is also an important component of solid catalysts for the production of butadiene and styrene. Bis(cyclopentadienyl)titanium (IV) dichloride is a potent carcinogen in animals and is mutagenic in bacteria. It has been shown to cause cancer in animal models, and has been shown to be mutagenic in bacterial mutation assay tests. Bis(cyclopentadienyl)titanium (IV) dichloride reacts with dimethylformamide and aromatic hydrocarbons to produce photochemical properties that can lead to skin irritation or sensitization. This compound also has hydroxyl groups, which can react with oxidants such as chlorine gas to form chlorohydrins, which are toxic compounds that may be carcinogenic.</p>

<p>Please enquire for more information about 2-Chloro-3-methoxybenzaldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about AQEE-30 (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Epinecidin-1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dnp-Pro-Leu-Gly-Leu-Trp-Ala-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-Chlorobenzotriazole is a nucleophilic reagent that can be used in analytical chemistry, such as the determination of propranolol hydrochloride. It reacts with phospholipid membranes by transferring a chlorine atom to the hydroxyl group on the lipid molecule. The reaction mechanism is not well understood, but it has been shown that the deuterium isotope effect is not involved in this reaction. 1-Chlorobenzotriazole is unsymmetrical and can react with both acidic and alkaline solutions. Hydrochloric acid is often used to activate this compound, which will then react with an amine group to form an iminium ion. Kinetics data for this compound show that activation energies are required for reactions involving nucleophiles, such as ketones, alcohols, or amines.</p>

<p>Amyloid beta-protein (Aβ) is a protein that is involved in the metabolic processes that are thought to be associated with Alzheimer's disease. Aβ is a peptide of 39-43 residues and is found in amyloid plaques, which are aggregates of Aβ. The amino acid sequence of human Aβ has been determined by sequencing the cDNA and gene for this protein. The structure of the protein has been studied using molecular modeling, kinetic data, and predictive biomarker studies. Cleavage products have been identified from the protein, including beta-amyloid peptide (1-40), which can be used as a diagnostic marker for Alzheimer's disease. Structural analysis has also shown lysine residues that may serve as pharmaceutical targets for therapeutic intervention.</p>

<p>Intermediate in the synthesis of ticagrelor</p>

<p>4-Iodo-1-methylpyrazole is a reductive agent that is used in organic synthesis. It can be used as a reducing agent for the conversion of aldehydes and ketones to alcohols. 4-Iodo-1-methylpyrazole can be crystallized from diethyl etherate and blood. The product yield from this reaction is high, but it requires an oxidant such as trifluoride or plavix to react with the diacetates. 4-Iodo-1-methylpyrazole can also be synthesized by reacting allylsilanes with iodine gas in the presence of a base. This synthesis method produces 4-iodo-1-methylpyrazole in good yield and with little difficulty.</p>

<p>Annexin A1 (1-11) is a peptide that is part of the annexin family. It is involved in the degranulation of cells and inhibits inflammation by inhibiting the production of pro-inflammatory cytokines. Annexin A1 (1-11) has been shown to be an anti-inflammatory compound as it binds to phospholipids on the surface of neutrophils, leading to inhibition of their chemotaxis and phagocytosis. This peptide also interacts with other annexins and prevents apoptosis by blocking caspase activity. Finally, it has been found that annexin A1 (1-11) can promote the healing of wounds in mice by accelerating reepithelialization and reducing scar formation. The concentration required for these effects are nanomolar concentrations.</p>

<p>Please enquire for more information about H-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CART (62-76) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Aminoacetophenone hydrochloride is a chemical compound that is used in analytical chemistry as a reagent for the determination of protein and amino acid concentrations. This reagent can be prepared in various forms, depending on the type of analysis being performed. 2-Aminoacetophenone hydrochloride is used to determine the concentration of free amino acids in a sample by binding to it. It can also be used for determining the concentration of bound amino acids by reacting with them with hydrochloric acid. 2-Aminoacetophenone hydrochloride is an excellent substrate for matrix effect, which may cause errors in measurement due to interference from other substances present in the sample. The use of light exposure reduces this problem by removing interfering substances from the sample.</p>

<p>2-(4-Chlorobenzyl)pyridine is a synthetic pyridine compound that has been shown to have anti-cancer properties. It is also a potent inducer of the enzyme methane monooxygenase and has been shown to interact with other compounds, such as maleates and sulfoxides, which are also used in this type of experiment. The catalytic mechanism for 2-(4-chlorobenzyl)pyridine is not yet known, but it may involve an acidic chlorine atom or a hydrochloric acid catalyst. 2-(4-Chlorobenzyl)pyridine has been found to be effective at inhibiting the growth of cancer cells in vitro without toxic effects on healthy cells. It has also been shown to inhibit the proliferation of human leukemia cells in vivo.</p>

<p>Intermediate in the synthesis of lenvatinib</p>

<p>Please enquire for more information about (D-Tyr5,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide YY (PYY) is a 36-amino acid peptide. It is cleaved from the larger protein, pancreatic polypeptide, by the enzyme dipeptidyl peptidase IV and circulates in plasma as PYY(3-36). The postprandial plasma levels of PYY are dose-dependent and increase with increasing doses of injected PYY. This response reflects the physiological effects of this hormone. A linear regression analysis revealed that PYY(3-36) has a significant effect on body weight loss and body mass index in humans. The effective dose for weight loss is yet to be determined, but it may be higher than 10 μg/kg/day.</p>

<p>Please enquire for more information about PAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Aminoethanesulphonamide monohydrochloride is a perovskite with a hexagonal shape. It has been shown to interact with the pharmacophore of the enzyme cytochrome P450, and it has been optimized for the reaction by altering its structure. This product is soluble in gaseous form, but can also be used as a solid. 2-Aminoethanesulphonamide monohydrochloride has an absorption maximum at 325 nm and emits fluorescence at 420 nm. It is used in devices that detect ionizing radiation.</p>

<p>(2R,3S)-3-Amino-2-hydroxy-3-phenylpropanoic acid hydrochloride is an organic compound that is used in the manufacture of taxol, an anticancer drug. It is synthesized by reacting chloroacetic acid with a metal hydroxide, such as sodium hydroxide or potassium hydroxide. The reaction proceeds spontaneously to form the enantiomerically pure (2R,3S) form and unreacted (2S,3R) form. The (2R,3S) enantiomer has been found to be more reactive than the (2S,3R) form. Quaternary ammonium salts are formed when the (2R,3S) enantiomer reacts with quaternary ammonium compounds such as benzyltrimethylammonium chloride. This compound can also be used in catalytic reactions to produce drugs such as carbapenems and pen</p>

<p>Please enquire for more information about Acetyl-ACTH (7-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cecropin B (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of osimertinib (AZD9291)</p>

<p>H-Lys-Cys-Thr-Cys-Cys-Ala-OH trifluoroacetate salt (KCTA) is a peptide that belongs to the group of thioneins and is characterized by a high content of lysine, cysteine and histidine residues. This peptide has been shown to be effective in treating subcutaneous tumors in mice. KCTA binds to metallothionein and gamma amino butyric acid (GABA), which are proteins that regulate energy metabolism in cells. KCTA has also been shown to have antimicrobial effects against human serum, which may be due to its ability to bind with thionein.</p>

<p>MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone is a peptidyl substrate for the enzyme carboxypeptidase A. This substrate has a high specificity for carboxypeptidase A and does not bind to other enzymes such as carboxypeptidase B, D, or L. The hydrophobic nature of this substrate has been shown in both hamsters and macaques. MeOSuc-Ala-Ala-Pro-Ala-chloromethylketone also shows cardiovascular effects in both animal models. It is possible that this effect is due to the proteolytic activity of the enzyme. More research needs to be done to identify the sequence of this peptide and how it may affect humans.</p>

<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D-Pen 2,p-chloro-Phe4,D-Pen 5)-Enkephalin H-Tyr-D-Pen-Gly-p-chloro-Phe-D-Pen (Disulfide bond) is a peptide that belongs to the family of opioid drugs. It has low potency and is used in pharmacological studies as a nonselective antagonist of δ-, μ-, and κ-(kappa) receptors. This drug blocks pain by binding to the same receptor sites that are activated by endogenous opioids and has been shown to be effective against both inflammatory and neuropathic pain. DPDPE has also been shown to have a high safety profile with minimal side effects.</p>

<p>9,9-Bis[4-(2-acryloyloxyethyloxy)phenyl]fluorene is a monofunctional, monomeric and optical initiator. It is a bifunctional molecule that can polymerize with other molecules to form polyesters. 9,9-Bis(4-acryloyloxyethyloxyphenyl)fluorene is also an element which can polymerize with other molecules to form polymers. This compound has been used in experiments for the study of optical properties such as refractive index and birefringence. The compound is liquid crystal and has been used for the study of liquid crystals as well.</p>

<p>T-type calcium channel inhibitor</p>

<p>2-Chloro-3,5-dinitrobenzotrifluoride is a chemical compound that is used as an intermediate in the synthesis of dyes and pharmaceuticals. It reacts with nitrous acid to form 2-chloro-3,5-dinitrobenzoic acid. The hydrogen bond between the hydroxyl group and the chlorine atom in this compound is weak, which leads to a constant value for its spectrometer. This chemical compound has photophysical properties that are dependent on the concentration of solutes. When it is mixed with other solutes such as potassium ion or sulfoxide, it can produce isomers. This chemical compound can be refluxed in a neutral pH environment to form anilines and acetonitrile, two compounds that are important for organic synthesis.</p>

<p>Please enquire for more information about Boc-Val-Pro-Arg-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)27)-Glucagon (1-29) (human, rat, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cis-Heptachlor epoxide is a metabolite of heptachlor, which is a pesticide. Cis-heptachlor epoxide has been detected in the blood of pregnant women, and in fetal cord blood. It has also been found in the liver microsomes of rats treated with heptachlor. Cis-heptachlor epoxide is an intermediate in the metabolism of heptachlor, but it can also be formed by hydrolysis of other pesticides containing chlorine atoms such as DDT and endosulfan. Cis-heptachlor epoxide is toxic to plants and animals, causing liver damage and inhibiting cellular respiration. There are no known studies on its toxicity to humans.</p>

<p>Please enquire for more information about Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Pro3)-Dynorphin A (1-11) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Asp-Glu-Val-Asp)2-Rhodamine 110 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-(2-Bromoethoxy)phthalimide is a chemical compound that has been shown to inhibit the activity of histone deacetylases. Histones are proteins that regulate gene expression and play an important role in the regulation of DNA transcription. The enzyme histone deacetylase (HDAC) removes acetyl groups from these proteins, which can lead to changes in gene expression and misregulation of cellular processes. HDACs have been linked to autoimmune diseases, such as arthritis and multiple sclerosis, because they can cause inflammation by affecting the production of inflammatory cytokines. N-(2-Bromoethoxy)phthalimide is able to inhibit HDACs by forming covalent bonds with the lysine residues on these enzymes. This inhibition causes modifications that affect the interaction between HDACs and their substrates, preventing them from modifying histones or interacting with other proteins.</p>

<p>Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH is a peptide that has been shown to have anti-cancer properties. The effect of Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe-OH on prostate cancer cells was studied in vitro by measuring the extent of cell growth. The results showed a dose dependent decrease in tumor growth rate, suggesting that this peptide may be useful as an adjuvant therapy for prostate cancer. Bradykinin (1-5) trifluoroacetate salt H-Arg-Pro-Pro-Gly-Phe has also been shown to inhibit diabetic nephropathy and reduce proteinuria in diabetic patients. This peptide may also be used to diagnose prostate cancer because it binds to the thrombin receptor, which is present on cancer cells but not</p>

<p>4-Bromo-1-indanone is a molecule that has been shown to have neuroprotective properties in vitro. It has also been shown to inhibit the amines, which may be due to its ability to act as an aromatic hydrocarbon. This molecule has not been approved for use as a drug substance or drug product and its safety and efficacy are unknown.</p>

<p>Please enquire for more information about Fibronectin Fragment (1376-1380) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4'-Bromo-2'-fluoroacetophenone is a bifunctional reagent that reacts with nucleophiles to form conjugates. It is used in the preparation of fluorinated DNA and RNA, as well as in electron-transfer reactions. The selectivity of 4'-bromo-2'-fluoroacetophenone can be attributed to the presence of fluorine atoms on both ends of the molecule.</p>

<p>Please enquire for more information about Tyr-alpha-CGRP (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Met(O)14-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1-(5-Bromopyrimidin-2-yl)ethanone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Chloro-4-hydroxybenzylamine hydrochloride is a versatile chemical that can be used as a reaction component, reagent, or useful scaffold in the synthesis of many organic compounds. It has a CAS number of 2418727-24-7 and is a fine chemical. This compound has been shown to be useful in the manufacture of other chemical products such as pharmaceuticals, pesticides, and dyestuffs.</p>

<p>Please enquire for more information about Neuropeptide W-23 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Gly-Asp-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>

<p>Please enquire for more information about (Cys0)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fluorescent Brightener 28 is a fluorescent dye that is used in the textile industry for staining and as a biological marker. It binds to the cell nuclei, which can be seen under ultraviolet light. Fluorescent Brightener 28 has been shown to have synergistic effects when combined with other dyes such as 4'6-diamidino-2-phenylindole (DAPI) and Thiazole orange. This dye is also used in diagnosis of opportunistic fungal infections, such as C. glabrata, by using flow cytometry or microscopy techniques. Fluorescent Brightener 28 has also been shown to inhibit the growth of wild-type strains of yeast, but not mutants resistant to this compound.</p>

<p>Please enquire for more information about Abz-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ser-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,5-Diiodo-4-hydroxybenzhydrazide is a chemical compound that is useful as a building block in organic synthesis. It is a versatile intermediate and can be used in the preparation of heterocyclic compounds and pharmaceuticals. 3,5-Diiodo-4-hydroxybenzhydrazide reacts with alkyl halides to form alkyl iodides, which are important reagents for organic synthesis. 3,5-Diiodo-4-hydroxybenzhydrazide has been used as an effective reagent for the formation of new carbon–carbon bonds and has been shown to be an excellent starting point for the synthesis of biologically active molecules.</p>

<p>Please enquire for more information about (D-Trp8)-gamma2-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>β2-agonist; used in management of preterm labor</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-ADAQHATPPKKKRKVEDPKDF-OH peptide, which can act as a substrate of Protein Kinase P34 (cd2). The peptide is supplied as a trifluoroacetate salt.</p>

<p>Ethylammonium tetrafluoroborate is an ionic liquid that is a colorless, nonvolatile liquid at room temperature. It has a melting point of -9 °C and a boiling point of 230 °C. This compound is soluble in water and organic solvents, but insoluble in diethyl ether. Ethylammonium tetrafluoroborate can be used as an electrolyte for lithium-ion batteries. The reversible oxidation reaction of ethylammonium tetrafluoroborate can be catalyzed by the addition of fluorine or carbonyl groups to the molecule. The NMR spectra of ethylammonium tetrafluoroborate show that it contains an alcohol group with a phase transition temperature near 35 °C and an activation energy near 15 kJ/mol. This compound also undergoes polymerization reactions with various types of monomers, such as vinyl acetate and methyl methacrylate,</p>

<p>Please enquire for more information about H-Ser-Leu-Ser-Leu-Ser-Pro-Gly-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 3-amino-4-bromo-2-nitrobenzoate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Chloro-2,5-dibromopyridine is a fine chemical that is used as a building block in the synthesis of other chemicals. It is a reagent and speciality chemical with high quality and complex structure. 3-Chloro-2,5-dibromopyridine is a versatile building block that can be used in the synthesis of many different compounds and as an intermediate or scaffold for other reactions. It has been shown to react with various nucleophiles, such as amines, alcohols, and thiols.</p>