Organic Halides

<p>6-Bromoindazole is a hydrogen bond inhibitor that has potential neuroprotective effects. It inhibits the enzyme DNA Gyrase, which is necessary for bacterial replication, and has antibacterial properties. 6-Bromoindazole interacts with the receptor tyrosine kinase axitinib and inhibits its activity. This interaction may be responsible for its neuroprotective effects.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-Cyclohexylethanamine hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Bromo-2-hydroxyphenyl)acetone is a chemical that is used as a building block in the synthesis of other compounds. It can be used as a reagent to produce 5-bromo-2,4-dihydroxyphenylacetic acid, which has been shown to have antiinflammatory and analgesic effects. 5-Bromo-2-hydroxyphenyl)acetone is also useful for the synthesis of polymers with applications in electronics and as an intermediate for the production of pharmaceuticals.</p>

<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Biotinyl-Hepcidin-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.</p>

<p>3,4-Dibromobenzoic acid ethyl ester is a high quality reagent that can be used as an intermediate for the synthesis of complex compounds. It is also useful as a building block for the synthesis of speciality chemicals and research chemicals. 3,4-Dibromobenzoic acid ethyl ester can be used in reactions such as Friedel-Crafts reactions, reducing reactions, and condensations. This chemical is a versatile building block that can be used to construct organic molecules with diverse structures. 3,4-Dibromobenzoic acid ethyl ester is a fine chemical with CAS number 60469-88-7.</p>

<p>Please enquire for more information about 1-(2,4-Dichlorobenzoyl)-2-(1-naphthoyl)hydrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-(3-Chloro-4-methoxyphenyl)acetone is a white solid with a melting point of 60-61°C. It is a versatile building block that can be used in the synthesis of complex compounds and as a reaction component for the preparation of speciality chemicals. 1-(3-Chloro-4-methoxyphenyl)acetone has been studied extensively as an intermediate for the synthesis of pharmaceuticals, including acetaminophen and amoxicillin. This compound also has uses in research laboratories and as a reagent in organic synthesis.</p>

<p>1-Bromo-3,3-dimethylbutane is an alkali metal compound that can be used as a substitute for ethylene. It is expressed in the liquid phase and reacts with halogens to form reactive intermediates. These reactive intermediates react with other molecules to cause bond cleavage. The reaction time is dependent on the temperature of the system. 1-Bromo-3,3-dimethylbutane has three isomers that are formed during the reaction: 2-, 3-, and 4-bromohexane. The mechanism for this reaction involves a single electron transfer from one molecule to another, which causes a series of reactions that leads to the formation of 1-bromo-3,3-dimethylbutane. This process occurs spontaneously due to irradiation by ultraviolet light or electron beams.</p>

<p>Butyl trifluoromethanesulfonate is an immunoregulatory agent that has been shown to have insulin-sensitizing and anti-inflammatory properties. It has been reported to cause a significant reduction in the concentration of glucose in the blood, which may be due to its ability to inhibit the synthesis of cholesterol esters. Butyl trifluoromethanesulfonate is also used as a solvent in detergent compositions, and as a reagent for synthesizing quinoline derivatives. This compound has been shown to increase the viscosity of oils and other organic solvents, making it useful for a wide range of industrial applications.</p>

<p>Please enquire for more information about Atrial Natriuretic Factor (1-28) (human) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Bromo-2-pyrrolecarboxaldehyde is a synthetic chemical that is used as an antifungal agent. It inhibits the growth of filamentous fungi by binding to their pyrrole rings and inhibiting the synthesis of proteins. 4-Bromo-2-pyrrolecarboxaldehyde has shown in vitro antifungal activity against isolates of Candida albicans, Aspergillus niger, and Fusarium oxysporum. This compound also has substitutions at positions 1 and 2 of the pyrrole ring, which are thought to be responsible for its inhibitory properties. 4-Bromo-2-pyrrolecarboxaldehyde is soluble in organic solvents such as acetone and chloroform.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of bictegravir</p>

<p>Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt is a potent, competitive inhibitor of matrix metalloproteinase (MMP) 3 and MMP9. It binds to the catalytic zinc ion in the active site of these enzymes. Dnp-Arg-Pro-Leu-Ala-Leu-Trp-Arg-Ser-OH trifluoroacetate salt has been shown to inhibit tumor growth and promote neuronal death in vitro. This drug also blocks the release of matrix metalloproteins from cells, which are involved in extracellular processes such as cell migration and cell adhesion.</p>

<p>CART (55-102) is a specific amino acid that has been shown to bind to the CART receptor. It has been found in human and rat tissue, including the brain, pituitary gland, and pancreas. This compound is thought to be involved in regulating appetite and energy expenditure. The CART (55-102) trifluoroacetate salt has been shown to be active in a variety of animal models for obesity and diabetes, as well as for reducing food intake.</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of mirabegron</p>

<p>Please enquire for more information about 8-Chloroimidazo[1,2-a]pyrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phe1,Ser2)-TRAP-6 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-2-fluoro-L-phenylalanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>

<p>2,5-Dinitrofluorene is a carcinogenic compound that has been shown to cause cancer in laboratory animals. It can be found in high concentrations in tissues of rats and other animals. 2,5-Dinitrofluorene is metabolized by nitroreductase to the amide form. This compound has been shown to cause cancer in rats and mice when administered intramammary or topically. The tumorigenicity of 2,5-dinitrofluorene is significant at high doses, but it does not show significant effects at low doses. This agent also causes tumours on the skin of mice when applied topically.<br>2,5-Dinitrofluorene is an environmental pollutant that may be found in air emissions from coal burning power plants and vehicle exhausts, as well as in the soil near these facilities.</p>

<p>Please enquire for more information about H-Tyr(tBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about D-(-)-2-Chlorophenylglycine methyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neurotensin (1-6) trifluoroacetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Chloro-2,4-pentanedione is a model system that has been used to study the reaction mechanism of the intramolecular hydrogen transfer. This molecule was found to be more reactive in the presence of sodium carbonate and anhydrous sodium, which is due to protonation of the hydroxyl group on the ethylene diamine. 3-Chloro-2,4-pentanedione reacts with carbon disulphide and ethylene diamine to form 2,5-dimethylhexane-1,6-diol. 3D molecular docking analysis has shown that this compound binds to the ryanodine receptor and may be a potential therapeutic agent for patients with carcinoma cell lines.</p>

<p>Furaltadone hydrochloride is a drug that belongs to the class of quinolones. It is used as an antibiotic for the treatment of microbial infections and may be used in combination with other antibiotics. Furaltadone hydrochloride binds to bacterial DNA, inhibiting protein synthesis, leading to cell death. The mechanism of action has not been fully elucidated, but it is thought that furaltadone hydrochloride binds to the sodium ion in the hydroxyl group of DNA. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Furaltadone hydrochloride has been shown to have a low systemic effect and high adsorption rate in animals; therefore it may be used as an oral antibiotic or as an injectable drug.</p>

<p>4,4'-Dibromobiphenyl is a diphenyl ether that is used in the synthesis of palladium complexes. It is also used as a carbon source for polymer films. The structural formula of 4,4'-dibromobiphenyl is C 12 H 10 Br 2 . This compound can be debrominated with hydrochloric acid to form biphenyl. 4,4'-Dibromobiphenyl has been shown to have anti-inflammatory properties and can be used as a specific antibody against dry weight.</p>

<p>1-(4,4'-Difluorobenzhydry)piperazine (1-DFBP) is a potential antitumor agent that has been shown to inhibit the growth of leukemia cells. It may be an inhibitor of apoptotic cell death, as it has been shown to induce hydrogen bond formation with coumarin derivatives. 1-DFBP has also been shown to have inhibitory activities against leukemia HL-60 cells, and is a competitive inhibitor of cinnarizine. The catalytic mechanism for 1-DFBP is not known, although kinetic data suggest that it involves hydrogen bonding and/or pi stacking interactions.</p>

<p>Please enquire for more information about pTH (1-84) (dog) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>