Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of C10orf30 antibody, catalog no. 70R-3881

A synthetic peptide for use as a blocking control in assays to test for specificity of CLPB antibody, catalog no. 70R-3956

A synthetic peptide for use as a blocking control in assays to test for specificity of PPIA antibody, catalog no. 70R-2333

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIB1 antibody, catalog no. 70R-9178

Rabbit polyclonal SERC3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Apbb1 antibody, catalog no. 70R-9328

A synthetic peptide for use as a blocking control in assays to test for specificity of IL1RL1 antibody, catalog no. 70R-7411

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM98A antibody, catalog no. 70R-4239

The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.

Voriconazole is an antifungal agent that inhibits the synthesis of ergosterol, a component of fungal cell membranes. It binds to the cytochrome P450 enzyme, which is involved in the conversion of lanosterol to ergosterol. Voriconazole has been shown to have potent inhibitory effects on ion channels and protein interactions. It is also used as a research tool for studying protein-protein interactions and receptor pharmacology. This compound can be used as an activator or inhibitor depending on its target.

Mumps virus is a contagious virus that causes mumps, a disease best known for swelling of the salivary (parotid) glands. This RNA virus is a part of the Paramyxoviridae family and is spread via respiratory droplets, direct contact, or contaminated surfaces. It causes symptoms such as fever, headache, muscle aches, fatigue, and painful swelling of parotid glands. Further complications can arise such as orchitis, oophoritis, meningitis, encephalitis and hearing loss.
This Mumps viral antigen is expressed in a Vero cell culture and has potential for use in research and diagnostic applications. The resulting antigen preparation consists of a high concentration of virus and viral components as well as some cellular material suspended in glycine buffer, pH 9.5. No preservative.

FABP4 is a fatty acid binding protein that has been shown to be over-expressed in cancer tissues. The FABP4 inhibitor, BMS309403, has been shown to inhibit the enzyme activity of FABP4, leading to the accumulation of fatty acids in tumor cells. This leads to cellular death by triggering apoptosis and necrosis. In addition, FABP4 inhibitors have anti-atherosclerotic effects and are being studied for their potential use as anti-obesity agents. These drugs may also have beneficial effects on mitochondrial function and neuronal function.

The Src antibody is a specific antibody used in Life Sciences research. It targets protein tyrosine kinases, specifically the Src family of kinases. This antibody has been shown to induce apoptosis in various cell types by activating the TNF-related apoptosis-inducing ligand (TRAIL) pathway. It can also inhibit the activity of interferon and epidermal growth factor signaling pathways. The Src antibody is available in stable liquid formulations for easy handling and storage. Whether you need a monoclonal or polyclonal antibody, the Src antibody is a reliable choice for your research needs. Additionally, studies have suggested that this antibody may have potential therapeutic applications in conditions such as hepatic steatosis.

HSV2 gE antibody (FITC) was raised in mouse using HSV 2, gE as the immunogen.

Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACHE antibody, catalog no. 70R-6077

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCB4 antibody, catalog no. 70R-6711

The RBM5 antibody is a powerful antiviral agent that belongs to the family of antibodies. It specifically targets proteins such as anti-mesothelin and alpha-fetoprotein, which are known to play a crucial role in various diseases. The RBM5 antibody has been shown to have neutralizing effects on these proteins, preventing them from causing harm to the body.

A synthetic peptide for use as a blocking control in assays to test for specificity of MGC46336 antibody, catalog no. 70R-8466

Lipoamido-dPEG®4-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®4-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.

Rabbit polyclonal CDH10 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of THYN1 antibody, catalog no. 70R-3715

A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEE1 antibody, catalog no. 70R-9504

Purified Polyclonal RPL28 antibody

Affinity purified Rabbit polyclonal Copine 3 antibody

CBR3 antibody was raised in Rabbit using Human CBR3 as the immunogen

Rabbit polyclonal Alpha enolase antibody (biotin)

Lipoamido-dPEG®12-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®12-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.

A synthetic peptide for use as a blocking control in assays to test for specificity of PPIE antibody, catalog no. 70R-1434

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2C antibody, catalog no. 70R-5588

A synthetic peptide for use as a blocking control in assays to test for specificity of ACTRT2 antibody, catalog no. 70R-2384

A synthetic peptide for use as a blocking control in assays to test for specificity of C8orf70 antibody, catalog no. 70R-7896

Inhibitor of fibroblast growth factor receptors FGFR1, FGFR2, FGFR3 and FGFR4

CD4a antibody (FITC) was raised in mouse using CD4a as the immunogen.

CEP-28122 is a potent antitumor agent that inhibits the growth of tumors by inhibiting the tyrosine kinase domain of the epidermal growth factor receptor (EGFR). CEP-28122 is activated by cyclin-dependent kinases to inhibit EGFR. It has been shown to be active in clinical studies for colorectal adenocarcinoma and other cancers. CEP-28122 has a high degree of selectivity for tumor cells, which are characterized by activation of the EGFR tyrosine kinase domain, and low toxicity for normal cells. The pharmacokinetic properties and molecular pathogenesis of this drug have been studied in detail.

The Cystatin B antibody is a highly specific and reliable tool for detecting and measuring Cystatin B levels in human serum samples. This polyclonal antibody has been extensively validated and shows excellent performance in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry.

Rabbit polyclonal Ku80 antibody (Thr714)

HJB97 is a heterobifunctional molecule that can be used in the development of new pharmaceuticals. It has been shown to inhibit cancer and inflammatory diseases. HJB97 is able to bind to ubiquitin, inhibiting the ubiquitination and proteasomal degradation of its target protein. HJB97 also has the ability to interact with bromodomains, inhibiting the transcriptional activity of these proteins. This dual-action makes HJB97 a potential anticancer agent as it inhibits cancer by preventing ternary complex formation and by inhibition of inflammatory disease through inhibition of stepwise activation.

TNFSF9 antibody was raised in rabbit using the C terminal of TNFSF9 as the immunogen

CD25 antibody (PE) was raised in rat using alpha chain IL-2 receptor as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC32A1 antibody, catalog no. 70R-6439

A synthetic peptide for use as a blocking control in assays to test for specificity of NEDD4 antibody, catalog no. 70R-3090

A synthetic peptide for use as a blocking control in assays to test for specificity of OR5T2 antibody, catalog no. 70R-6531

A synthetic peptide for use as a blocking control in assays to test for specificity of AP3S1 antibody, catalog no. 70R-9130

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

Bicalutamide-d4 is a monocarboxylic acid that is a competitive inhibitor of androgens. It binds to the cytosolic receptor and blocks the action of dihydrotestosterone (DHT). Bicalutamide-d4 has been shown to be effective in reducing prostate cancer tumour growth, but not in treating prostate cancer. This drug is non-steroidal and acts as an antagonist of androgen receptors. Bicalutamide-d4 has been shown to induce the production of monocarboxylic acid metabolites such as sulfone and amide, which have anti-inflammatory effects on tissues.

The Aldolase antibody is a highly specialized protein used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets various proteins, including caspase-9, endonuclease, and β-catenin, among others.

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNN2 antibody, catalog no. 70R-5106

A synthetic peptide for use as a blocking control in assays to test for specificity of LENG4 antibody, catalog no. 70R-7358

Affinity purified Rabbit polyclonal PPP1R15B antibody

CD45.2 antibody (Spectral Red) was raised in mouse using CD45.2 as the immunogen.

Affinity purified Rabbit polyclonal SNTB2 antibody

CD3 antibody (Allophycocyanin-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of AGBL5 antibody, catalog no. 70R-3580

Affinity purified Rabbit polyclonal ST3GAL2 antibody

t-boc-N-Amido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

Affinity purified Rabbit polyclonal MAF1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TD1 antibody, catalog no. 70R-3036

A synthetic peptide for use as a blocking control in assays to test for specificity of UBQLN3 antibody, catalog no. 70R-2645

CD38 antibody (Spectral Red) was raised in rat using CD38 as the immunogen.

CD122 antibody (FITC) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.

Purified recombinant Adiponectin protein (Mouse)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF554 antibody, catalog no. 70R-8420

NDOR1 antibody was raised in Rabbit using Human NDOR1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TRPV5 antibody, catalog no. 70R-5176

CD45RB antibody (biotin) was raised in rat using cloned murine Th2 cell lines as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of DAB1 antibody, catalog no. 70R-4084

CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.

Rabbit polyclonal CHMP2A antibody (HRP)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC23A3 antibody, catalog no. 70R-6805

A synthetic peptide for use as a blocking control in assays to test for specificity of CDH12 antibody, catalog no. 70R-6130

2,4-Diphenyl-1,3-diselenadiphosphetane 2,4-diselenide is a versatile reagent that has various applications in research and chemical synthesis. It can be used as a precursor for the synthesis of phorbol analogs, which are compounds known for their potential anti-cancer properties. Additionally, this compound has been studied for its ability to mimic the effects of cysteamine, an amino acid analog that has shown promise in treating certain genetic disorders and diabetes. In addition to its role in chemical synthesis, 2,4-Diphenyl-1,3-diselenadiphosphetane 2,4-diselenide has also been investigated for its potential health benefits. Studies have suggested that it may have antioxidant properties and could potentially help protect against oxidative stress-related diseases. Furthermore, research has shown that this compound exhibits neuroprotective effects and may have a positive impact on brain health. Please note that 2,4-D

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM135 antibody, catalog no. 70R-6274

H-Thr-Glu-OH is a nucleotide that is a component of RNA. It is one of the 20 natural amino acids and it is found in proteins as well as in RNA molecules. H-Thr-Glu-OH can be synthesized by hydrolysis of proteins with an enzyme called glutamic acid hydrolase. H-Thr-Glu-OH has been shown to have a high affinity for lysine, which has been shown to be required for the enzymatic activity of many protein enzymes. This amino acid can also be found in large quantities in cheese, soy sauce, and yogurt.

A synthetic peptide for use as a blocking control in assays to test for specificity of MDH1B antibody, catalog no. 70R-3381

A synthetic peptide for use as a blocking control in assays to test for specificity of ENO3 antibody, catalog no. 70R-1218

ENC1 antibody was raised in Rabbit using Human ENC1 as the immunogen

The MMP9 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It has been specifically designed to target and bind to the activated form of matrix metalloproteinase 9 (MMP9). This biomolecule plays a crucial role in various physiological and pathological processes, including cell-extracellular matrix interactions, tissue remodeling, and inflammation.

FGF19 antibody is a highly specialized drug antibody that targets fibroblast growth factor 19 (FGF19). FGF19 is a growth factor that plays a crucial role in regulating the metabolism of fatty acids. This antibody has been developed for use in antiestrogen therapy, as it can effectively block the activity of FGF19 and inhibit its effects on adipose tissue.

A synthetic peptide for use as a blocking control in assays to test for specificity of Galnt3 antibody, catalog no. 70R-8653

A synthetic peptide for use as a blocking control in assays to test for specificity of FTO antibody, catalog no. 70R-4523

A synthetic peptide for use as a blocking control in assays to test for specificity of GPR161 antibody, catalog no. 70R-1845

A synthetic peptide for use as a blocking control in assays to test for specificity of PKLR antibody, catalog no. 70R-1230

The PDPN antibody is a monoclonal antibody used in the field of Life Sciences. It is commonly known as an antiphospholipid antibody and has been extensively studied for its role in various biological processes. This antibody specifically targets podoplanin, a glycoprotein expressed on the surface of many cell types.

A synthetic peptide for use as a blocking control in assays to test for specificity of PYHIN1 antibody, catalog no. 70R-9020

A synthetic peptide for use as a blocking control in assays to test for specificity of FXYD5 antibody, catalog no. 70R-1683

The Connexin 43 antibody is a highly specialized antibody used in Life Sciences research. It targets the protein Connexin 43, which plays a crucial role in cell communication and signaling. This antibody is available in both polyclonal and monoclonal forms.

ATP1B1 antibody was raised in Rabbit using Human ATP1B1 as the immunogen

The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYCP3 antibody, catalog no. 70R-2271

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP3A7 antibody, catalog no. 70R-7496

A synthetic peptide for use as a blocking control in assays to test for specificity of SIRPA antibody, catalog no. 70R-10426