Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,560 products)
- By Biological Target(101,036 products)
- By Pharmacological Effects(6,953 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
MC4R antibody
MC4R antibody is a polyclonal antibody that specifically targets the melanocortin 4 receptor (MC4R). It is widely used in life sciences research to study adipose tissue and its related functions. This antibody has been shown to have neutralizing properties against angptl3, a protein involved in lipid metabolism. The MC4R antibody can be used in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA). It is available in both monoclonal and polyclonal forms, allowing researchers to choose the most suitable option for their experiments. With its high specificity and sensitivity, the MC4R antibody is an essential tool for studying the role of MC4R in various physiological processes and developing potential therapeutic interventions.AR antibody
The AR antibody is a monoclonal antibody that specifically targets the androgen receptor (AR). It has been extensively studied and proven to be highly effective in various research applications within the Life Sciences field. The AR antibody can be used for experiments involving alpha-fetoprotein, endogenous hematopoietic cells, epidermal growth factor signaling, actin filaments, growth factors, fibronectin, chemokines, antibodies, interferon-gamma (IFN-gamma), human folate metabolism, and many other areas of study.Goat anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%B3GALTL antibody
B3GALTL antibody was raised using the middle region of B3GALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEPurity:Min. 95%AURKA antibody
The AURKA antibody is a highly effective neutralizing agent used in Life Sciences research. It belongs to a class of inhibitors that target specific proteins involved in cellular processes. This monoclonal antibody has been extensively tested and proven to be highly cytotoxic against various cancer cell lines. In addition, it has shown promising results in inhibiting the growth factor signaling pathway and blocking the activity of leukemia inhibitory factor. The AURKA antibody is derived from human serum and exhibits excellent specificity and affinity for its target protein. Its colloidal nature allows for easy handling and application in various experimental setups. Researchers can rely on this monoclonal antibody to accurately detect and quantify the presence of hormone peptides, autoantibodies, and other biomolecules of interest.
HAO2 antibody
HAO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEISAPICIAPTGFHCLVWZNF582 antibody
ZNF582 antibody was raised in rabbit using the N terminal of ZNF582 as the immunogenPurity:Min. 95%KIF5B antibody
KIF5B antibody was raised using the N terminal of KIF5B corresponding to a region with amino acids CNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTPurity:Min. 95%COX4I1 antibody
COX4I1 antibody was raised in Mouse using a purified recombinant fragment of human COX4I1 expressed in E. coli as the immunogen.AZD 8329
CAS:AZD 8329 is an orally active, small-molecule inhibitor of the enzyme fatty acid synthase (FAS) that has been shown to be safe and well tolerated in clinical trials. It is currently being studied as a potential treatment for obesity, type 2 diabetes mellitus, and other metabolic disorders. AZD 8329 has a novel mechanism of action that blocks the synthesis of fatty acids, which are a major energy source in the body. This drug also inhibits adipose tissue lipolysis and suppresses appetite. The drug's effects on insulin sensitivity have not been fully elucidated, but it may represent an alternative to thiazolidinediones such as rosiglitazone because it does not appear to increase cardiovascular risk or cause edema. AZD 8329 was found to inhibit FAS activity by competitive inhibition with microglial activation in vitro with up to 95% inhibition at concentrations of 10 μM. In vivo studies demonstrated that AZD 8329 effectively reducedFormula:C25H31N3O3Purity:Min. 95%Molecular weight:421.5 g/molZonisamide-13C2-15N
CAS:Zonisamide-13C2-15N is a labeled form of zonisamide, which belongs to the group of ion channel blockers. It is used as a research tool in cell biology and pharmacology. This compound has been shown to be an inhibitor of protein interactions with peptides and antibodies. Zonisamide-13C2-15N has been used to study the activation mechanism for beta adrenergic receptors and serotonin 5HT1A receptors.Formula:C613C2H8N15NO3SPurity:Min. 95%Molecular weight:215.2 g/molRat anti Mouse IgG1 Heavy Chain (biotin)
Mouse IgG1 heavy chain antibody (biotin) was raised in rat using murine IgG1 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molEST73502 hydrochloride
CAS:EST73502 hydrochloride is a potent and selective activator of TRPA1 ion channels. It binds to the extracellular domain of TRPA1, which is located on the cytoplasmic side of the cell membrane. EST73502 hydrochloride has been shown to modulate neuronal activity in cultured cells. This compound may be used as a research tool for studying protein interactions and for developing new drug targets. TRPA1 activation by EST73502 hydrochloride leads to an increase in intracellular calcium levels, which can lead to neuronal excitation, pain perception, and other effects.Formula:C19H27ClF2N2O2Purity:Min. 95%Molecular weight:388.9 g/mol(2S,3R)-3-Hydroxy-2-((R)-5-isobutyryl-1-oxo-2,5-diazaspiro(3.4)octan-2-yl)butanamide
CAS:This is a research tool for the study of ion channels. It is an activator of ligand-gated ion channels and can serve as a substitute for glutamate in experiments on the activation mechanism of ligand-gated ion channels. It also has been shown to be an antagonist at nicotinic acetylcholine receptors and an allosteric modulator at GABA-A receptors. This product is offered in high purity with >99% purity.Formula:C14H23N3O4Purity:Min. 95%Molecular weight:297.35 g/molPROTAC CDK9 Degrader-1
CAS:PROTAC CDK9 Degrader-1 is a combination therapy that includes two different types of drugs. One drug inhibits the activity of cyclin-dependent kinases (CDKs). The other drug inhibits the activity of autophagy enzymes. Together, these drugs inhibit the growth of cancer cells and are currently being investigated as a treatment for leukemia and lymphoma in human patients.
Formula:C33H35N5O7Purity:Min. 95%Molecular weight:613.66 g/molACHP
CAS:Achyranthes bidentata polysaccharide (ABP) is a chinese herb that has been used in traditional Chinese medicine for the treatment of various diseases. ABP is a protein synthesis inhibitor, and it also inhibits the transcriptional regulation of NF-κB DNA binding. It has shown to be effective in vitro against carcinoma cells lines, cell culture, and p24 antigen levels. This drug should not be used in patients with autoimmune diseases or congestive heart failure. Achyranthes bidentata polysaccharide should not be taken by patients with collagen disease because it may lead to increased degradation of collagen.Formula:C21H24N4O2Purity:Min. 95%Molecular weight:364.44 g/molErso
CAS:Erso is a medicinal compound that has been developed to target cancer cells by disrupting the cell cycle and inducing apoptosis. It works by inhibiting the activity of kinases, which are enzymes that play a key role in regulating cell growth and division. Erso has shown promising results in preclinical studies, demonstrating its ability to inhibit tumor growth and induce cancer cell death in both Chinese hamster ovary cells and human cancer cell lines. The protein inhibitor also shows potential for use as a diagnostic tool, as it can be detected in urine samples of patients with certain types of cancer. With its targeted approach to fighting cancer, Erso is poised to become an important tool in the fight against this devastating disease.
Formula:C22H13F6NO3Purity:Min. 95%Molecular weight:453.3 g/molMeseclazone
CAS:Meseclazone is a non-steroidal anti-inflammatory drug (NSAID) that is used to treat inflammation, pain, and stiffness caused by arthritis. Meseclazone is a prodrug that is converted in vivo to mesalazine, its active form. Mesalazine has been shown to have biological properties that are similar to acetylsalicylic acid, including ionotropic gelation. This drug also has the ability to form hydrogen bonds with acidic or basic groups, which helps it act as a cavity filler. Meseclazone also contains a carbonyl group and hydrochloric acid, which can be used for the synthesis of other drugs.
Formula:C11H10ClNO3Purity:Min. 95%Molecular weight:239.65 g/molN2-[2-[4-[(2-Naphthalenylcarbonyl)amino]phenyl]acetyl]-L-arginyl-L-isoleucyl-L-α-aspartyl-N-[(2S)-2-methylbutyl]-L-argininamide
CAS:N2-[2-[4-[(2-Naphthalenylcarbonyl)amino]phenyl]acetyl]-L-arginyl-L-isoleucyl-L-α-aspartyl-N-[(2S)-2-methylbutyl]-L-argininamide is a synthetic peptide drug, which is a product of advanced chemical synthesis processes. It functions as a selective inhibitor, targeting specific proteolytic enzymes involved in pathological conditions. The molecular structure allows it to engage in precise interactions with target enzymes, thereby modulating biological pathways and offering therapeutic potential.Formula:C46H66N12O8Purity:Min. 95%Molecular weight:915.09 g/molCAY10566
CAS:CAY10566 is a novel compound that has been shown to induce apoptosis in cells. It binds to the cytosolic protein cytochrome c, which is involved in the mitochondrial electron transport chain. This binding leads to an increase of intracellular levels of hydrogen peroxide and reactive oxygen species (ROS), leading to increased cell apoptosis. CAY10566 also inhibits autophagy, a process that assists in the degradation of cellular components during starvation or other unfavorable conditions. This drug was also found to inhibit cell growth and proliferation by suppressing the MAPK/AMPK pathway, which regulates cellular metabolism and growth.Formula:C18H17ClFN5O2Purity:Min. 95%Molecular weight:389.82 g/molPhg-Gly-OH
CAS:Please enquire for more information about Phg-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H12N2O3Purity:Min. 95%Molecular weight:208.21 g/molTNF-± Antagonist III, R-7050
CAS:TNF-± Antagonist III is a drug that is used to inhibit the production of TNF-α. It has been shown to regulate transcriptional activity in cells and to inhibit the growth of cancer cells. TNF-± Antagonist III has been observed to decrease the M2 phenotype, which may be due to its ability to activate ATP levels in macrophages. This drug also inhibits kidney fibrosis by reducing pro-inflammatory factors, such as tumor necrosis factor-α (TNF-α) and fatty acids. The drug also has effects on abdominal surgery, as it reduces inflammation following this type of procedure. TNF-± Antagonist III is used in fat tissue and adipose tissue, where it reduces the number of pro-inflammatory factors produced by macrophages.
Formula:C16H8ClF3N4SPurity:Min. 95%Molecular weight:380.77 g/molBMS-582949
CAS:BMS-582949 is an investigational pharmaceutical compound, specifically a chemokine receptor antagonist, that has been derived through synthetic chemical processes. Its mode of action involves selectively inhibiting the C-C chemokine receptor type 2 (CCR2), a receptor involved in the migration and activation of monocytes and other immune cells. By blocking CCR2, BMS-582949 aims to modulate inflammatory pathways that are implicated in various diseases.Formula:C22H26N6O2Purity:Min. 95%Molecular weight:406.48 g/molPNRI-299
CAS:PNRI-299 is a synthetic small molecule that has been shown to inhibit cancer cell growth by targeting the transcriptional regulator protein, nuclear factor κB (NF-κB). NF-κB is a redox signal that regulates the expression of genes involved in cellular responses to stress. PNRI-299 has been shown to suppress the expression of these genes, leading to decreased proliferation and increased apoptosis. PNRI-299 also inhibits the transition from G1 to S phase in cells; thus it may be used as an anti-cancer drug.Formula:C21H15N5O4Purity:Min. 95%Molecular weight:401.4 g/molTopfluor pi(4,5)P2
CAS:Topfluor PI(4,5)P2 is a synthetic phosphoinositide, which is chemically modified to include a fluorophore for advanced biological research. It is derived from phosphatidylinositol 4,5-bisphosphate, a critical lipid found in eukaryotic cell membranes. The fluorophore allows researchers to visualize and track the behavior of phosphoinositides in real-time using fluorescence microscopy techniques.Formula:C50H78BF2N3O20P3Purity:Min. 95%Molecular weight:1,182.89 g/molCGM-097
CAS:CGM-097 is a potent antitumor agent that targets senescent cells. It is a monoclonal antibody that specifically binds to the apoptosis protein, which prevents its translocation to the nucleus and induces apoptosis. CGM-097 has been shown to have potent antitumor activity in vivo models of melanoma and BCR-ABL positive leukemia. CGM-097 has been shown to be chemically stable in vitro and in vivo, with no significant toxicity observed at higher doses. The drug’s synergistic effects are due to its ability to target both tumor cells and their surrounding microenvironment, as well as upregulating genes involved in cell death and immune response.Formula:C38H47ClN4O4Purity:Min. 95%Molecular weight:659.26 g/molTemarotene
CAS:Temarotene is an all-trans retinoic acid (ATRA) analog that binds to the IL-2 receptor with high affinity and specificity. It has been shown to inhibit the proliferation of HL-60 cells in vitro, which may be due to its ability to induce the release of colony-stimulating factor from these cells. Temarotene also enhances the uptake of ATRA by HL-60 cells and increases the expression of receptors for ATRA in humans. In vivo studies have shown that temarotene is a potent inducer of fatty acid synthesis in Sprague-Dawley rats. This agent has a long half-life and is rapidly absorbed when administered orally, with peak plasma concentrations occurring 2 hours after administration. The pharmacokinetic properties of this drug are similar to those of other synthetic retinoids, such as all-trans-retinoic acid.
Formula:C23H28Purity:Min. 95%Molecular weight:304.5 g/mol2-Methyl-3-[4-(3-pyrrolidin-1-ylpropoxy)phenyl]-5-(trifluoromethyl)quinazolin-4-one
CAS:2-Methyl-3-[4-(3-pyrrolidin-1-ylpropoxy)phenyl]-5-(trifluoromethyl)quinazolin-4-one is a potent and selective inhibitor of the type I phosphodiesterase (PDE1). It has been shown to inhibit PDE1 in human platelets and erythrocytes. It also inhibits the activation of protein kinase C by thrombin. This agent binds to a region on PDE1 that does not overlap with the binding site for most PDE inhibitors, suggesting that it may be useful as an alternative treatment for conditions such as asthma and inflammation.
Formula:C23H24F3N3O2Purity:Min. 95%Molecular weight:431.4 g/molNaloxone
CAS:Controlled Productµ- and Ύ-opioid receptor antagonist; antidote for opioid overdoseFormula:C19H21NO4Purity:Min. 95%Color and Shape:PowderMolecular weight:327.37 g/molc18 D-Threo ceramide (d18:1/18:0)
CAS:Please enquire for more information about c18 D-Threo ceramide (d18:1/18:0) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C36H71NO3Purity:Min. 95%Molecular weight:566 g/molBiocytin
CAS:Biocytin is a naturally occurring biogenic amine. It is one of the major metabolic products of tryptophan, and can be found in many tissues and body fluids. Biocytin is an important intermediate in the synthesis of catecholamines from tyrosine, as well as in the synthesis of dopamine from l-DOPA. It is also a precursor to other biologically active molecules such as serotonin and melatonin. Biocytin has been shown to have a role in axonal growth, and may play a role in various neurological disorders such as metabolic disorders or hippocampal formation. Biocytin can also be used for analytical purposes due to its ability to bind proteins.Formula:C16H28N4O4SPurity:Min. 95 Area-%Color and Shape:PowderMolecular weight:372.48 g/molGR127935
CAS:GR127935 is a small-molecule, high-quality peptide that belongs to the class of activators. It is a ligand that binds to the receptor and increases the affinity of the receptor for its natural ligand. GR127935 has been shown to activate ion channels by binding to the receptor. This compound is used in research as an inhibitor or as a tool to study protein interactions. GR127935 interacts with many different receptors, including those for dopamine, acetylcholine, serotonin, and histamine. It also binds to nicotinic acetylcholine receptors (nAChRs), which are found in muscle cells and are important for movement.Formula:C29H31N5O3Purity:Min. 95%Color and Shape:PowderMolecular weight:497.6 g/molMSG 606
CAS:MSG 606 is a mitochondrial fission inhibitor that has been shown to reduce microglial activation, neuroinflammation and the release of neutrophils from the bone marrow. This drug also has neuroprotective properties and can be used for treatment of neurodegenerative disorders. MSG 606 is an investigational drug, not approved for human use.
Formula:C62H82N20O13SPurity:Min. 95%Molecular weight:1,347.5 g/molKcc2 blocker 1
CAS:Please enquire for more information about Kcc2 blocker 1 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C22H25NO5SPurity:Min. 95%Molecular weight:415.5 g/molZD 7114 hydrochloride
CAS:ZD 7114 hydrochloride is a drug that activates the PPAR-α receptor. It has been shown to increase glucose uptake in the adipose tissue of mice and increase insulin sensitivity, which may be due to its ability to decrease fatty acid synthesis. ZD 7114 hydrochloride also increases lipid catabolism in the liver and adipose tissue, leading to weight loss. ZD 7114 hydrochloride also has an effect on body temperature, increasing heat production by up to 13%.Formula:C22H30N2O6·HClPurity:Min. 95%Molecular weight:454.94 g/molE7090 succinate
CAS:E7090 succinate is a Research Tool that is used in Cell Biology and Pharmacology. It is an inhibitor of Ion channels, Ligand, Peptides, Receptor, and High purity. E7090 succinate has been shown to activate the ion channel TRPV4 on the membrane of cells. E7090 succinate also binds to the receptor for substance P in cultured cells. E7090 succinate has been shown to be a specific ligand for the CXCR4 receptor in human T-cells. This product is a high purity, life science reagent that can be used in protein interactions and antibody production.Formula:C32H37N5O6•(C4H6O4)1Purity:Min. 95%Molecular weight:764.82 g/molLy 456236 hydrochloride
CAS:Allosteric modulation of the dopamine receptor is a novel therapeutic approach to treat neurodegenerative disorders such as Parkinson's disease. Ly 456236 hydrochloride (LY456236) is an allosteric modulator that can regulate the activity of the D2 dopamine receptor by binding to an allosteric site. It has been shown to be neuroprotective in animal models and has clinical properties in humans. LY456236 does not bind to the glutamate or nicotinic acetylcholine receptors and does not cause locomotor activity or cholinergic symptoms. LY456236 also shows antidepressant effects, which may be due to its ability to regulate serotonin neurotransmission.Formula:C16H16ClN3O2Purity:Min. 95%Molecular weight:317.77 g/molItraconazole-d5 (major)
CAS:Itraconazole-d5 is a fluorescent derivative of itraconazole that is used for the detection of eosinophil cationic protein in the diagnosis of asthma. It binds to wild-type strains and inhibits fungal enzyme activities, such as concentration–time curves and minimal toxicity. The hydrogen bonding interactions between itraconazole-d5 and its target molecule are stronger than those between itraconazole and its target molecule. Itraconazole-d5 has been shown to inhibit the production of cationic proteins by inhibiting the activity of enzymes, such as polymerase chain reaction (PCR) and reverse transcriptase (RT), which are required for DNA synthesis.
Formula:C35H38Cl2N8O4Purity:Min. 95%Molecular weight:710.7 g/molITMN 4077
CAS:ITMN 4077 is an ion channel activator that belongs to the group of peptides. It is a synthetic peptide with a high purity, and has been shown to be an inhibitor of sodium channels in neuronal cells. ITMN 4077 may be used as a research tool to study protein interactions, such as those between ion channels and their ligands. This compound may also be used for pharmacological purposes or for the treatment of diseases caused by abnormal ion channel activity, such as epilepsy or chronic pain.
Formula:C26H40N4O8SPurity:Min. 95%Molecular weight:568.68 g/mol(Piperidin-1-yl)methanone
CAS:piperidin-1-yl)methanone is a research tool that has been shown to activate ligands and receptors, to inhibit ion channels, and to bind to antibodies. It is a white crystalline solid that is soluble in organic solvents. Piperidin-1-yl)methanone has been used in cell biology as an activator or inhibitor of protein interactions, peptides, and life science applications such as pharmacology and antibody production. This chemical can be used in the study of ion channels, including voltage gated channels, ligand-gated channels, and receptor-gated channels.Formula:C21H22N4OPurity:Min. 95%Molecular weight:346.4 g/molKP372-1
CAS:KP372-1 is a selective inhibitor that is synthetically derived. This compound functions by targeting and interfering with specific signaling pathways involved in cell growth and survival. Its inhibitory action primarily affects pathways such as PI3K/Akt, which are integral to the processes of cellular proliferation and apoptosis.Formula:C20H8N12O2Purity:Min. 95%Molecular weight:448.4 g/molSPDH
CAS:SPDH reacts with primary amines via its NHS ester and forms disulfide bonds via the pyridyldithiol group. The cleavage occurs intracellularly.Formula:C15H18N2O4S2Purity:Min. 95%Molecular weight:354.44 g/molQC 6352
CAS:Histone lysine demethylase subfamily 4 (KDM4) inhibitorFormula:C24H25N3O2Purity:Min. 95%Molecular weight:387.47 g/molPim1/AKK1-IN-1
CAS:Pim1/AKK1-IN-1 is a new anticancer drug that is currently in clinical trials. It has been shown to be effective against breast cancer and prostate cancer cells, as well as cells from other types of cancers such as leukemia and lymphoma. This compound induces cell death by binding to DNA and inhibiting the synthesis of proteins needed for cell division. Pim1/AKK1-IN-1 also inhibits estrogen synthesis, which may explain its effectiveness against cancer cells that are dependent on estrogen for survival. There is no information available about the mechanism of action of this drug in women.Formula:C20H13N5OPurity:Min. 95%Molecular weight:339.35 g/molThermorubin
CAS:Thermorubin is a natural compound that inhibits protein synthesis and RNA synthesis. Thermorubin is a methyltransferase inhibitor, which prevents the conversion of s-adenosylhomocysteine to adenosine triphosphate, leading to cell death by inhibiting protein synthesis and RNA synthesis. Thermorubin has been shown to be effective against viruses such as influenza A and mouse melanoma cells. In addition, this compound can inhibit the growth of intestinal bacteria and may be used in the treatment of gastrointestinal infections. Thermorubin is also active against thermophilic bacteria and can be used for the treatment of wounds infected with these bacteria. The shikimate pathway is inhibited by thermorubin, which leads to inhibition of polyethylene glycols.Formula:C32H24O12Purity:Min. 95%Molecular weight:600.5 g/mol5α-7,24-Cholestadiene-d6
CAS:Controlled Product5α-7,24-Cholestadiene-d6 is a peptide that can be used as an activator. It is also an inhibitor of ion channels and may be used to study the effects of ligands on the activation of protein interactions. This product is highly pure and has been shown to inhibit cell division in cancer cells. 5α-7,24-Cholestadiene-d6 can be used as a research tool for studying pharmacology, physiology, and biochemistry.Formula:C27H38D6OPurity:Min. 95%Molecular weight:390.67 g/molALK inhibitor 2
CAS:ALK inhibitor 2 is a protein kinase that inhibits the enzyme that phosphorylates tyrosine to form protein kinase A. Protein kinases are enzymes that transfer phosphate groups from ATP to specific amino acids in proteins, altering their function. The inhibition of ALK by this drug is post-transcriptional and cancer-related, resulting in regulation of cell growth and normalizing cellular processes. This drug has been shown to be effective in cancer therapy and is able to restore the balance of signaling pathways in cancer cells as well as regulate the expression of cancer-related genes.Formula:C23H28ClN7O3SPurity:Min. 95%Molecular weight:518.03 g/molRilpivirine-d6
CAS:Rilpivirine-d6 is a deuterated, stable isotope of rilpivirine. It is used to investigate the metabolism of drugs in plasma samples and tissues for bioequivalence studies. Rilpivirine-d6 is used as an internal standard in quantitative analysis by mass spectrometry. The stability of this molecule enables it to be used in prolonged studies without significant degradation. Rilpivirine-d6 has been shown to reduce viral load and increase CD4+ T cell counts in HIV patients who are on antiretroviral therapy. Rilpivirine-d6 binds to the reverse transcriptase enzyme and prevents the formation of DNA from RNA, thus inhibiting viral replication.
Formula:C22H18N6Purity:Min. 95%Molecular weight:372.5 g/molCollismycin A
CAS:Collismycin A is a biocompatible polymer with a strong antimicrobial activity. It has been shown to act as an inhibitor of the picolinic acid-dependent, nitrogen atom-containing enzyme, alpha-ketoglutarate aminotransferase. This inhibition leads to a decrease in the production of inflammatory mediators and autoantibodies. Collismycin A has also been shown to have immunomodulatory properties and may be useful for treating autoimmune diseases.
Formula:C13H13N3O2SPurity:Min. 95%Molecular weight:275.33 g/molIRAK inhibitor 1
CAS:IRAK inhibitor 1 is a protein kinase inhibitor that blocks the activation of IRAK, which is a kinase. This inhibition leads to the suppression of cancer-related genes and the normalization of protein synthesis. This drug has been shown to be effective in cancer therapy and may also have potential as an adjuvant in other treatments such as chemotherapy.Formula:C17H19N5Purity:Min. 95%Molecular weight:293.37 g/mol(S)-(-)-Nicotine-d4
CAS:Please enquire for more information about (S)-(-)-Nicotine-d4 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H14N2Purity:Min. 95%Molecular weight:166.26 g/molGPR40 agonist 4
CAS:GPR40 Agonist 4 is a high purity, Life Science, Pharmacology, CAS No. 2102196-57-4, Ligand, Receptor, Activator, Research tool. It is used in Cell Biology and Ion channels research. GPR40 Agonist 4 has been shown to activate the G protein coupled receptor (GPCR) GPR40. This activation leads to an increase in intracellular calcium levels that can be measured with fluorescently labeled calcium indicator dyes. In addition to its use as a research tool for studying GPR40 function and structure, this compound may be useful for the treatment of certain diseases such as obesity or diabetes.Formula:C21H17ClO5SPurity:Min. 95%Molecular weight:416.87 g/molDinitrodenafil
CAS:Dinitrodenafil is a synthetic phosphodiesterase type 5 (PDE5) inhibitor, which is developed through chemical synthesis. Its mode of action involves inhibiting the PDE5 enzyme, leading to increased levels of cyclic guanosine monophosphate (cGMP) in smooth muscle cells. This results in vasodilation and improved blood flow, particularly in the corpus cavernosum of the penis.Formula:C17H18N6O6Purity:Min. 95%Molecular weight:402.4 g/molIpazine
CAS:Ipazine is a medicinal compound that has shown potent anticancer activity in human tumor cells. It is an inhibitor of kinases, which are enzymes involved in the regulation of cell cycle and apoptosis. Ipazine has been shown to induce apoptosis in leukemia cells and inhibit the growth of cancer cells in vitro. This compound is derived from Chinese herbal medicine and can be isolated from urine samples. Ipazine is a promising candidate for the development of novel anticancer drugs and may offer new therapeutic options for cancer patients. Its ability to selectively target cancer cells without harming healthy tissue makes it a valuable addition to the arsenal of cancer-fighting agents.Formula:C10H18ClN5Purity:Min. 95%Molecular weight:243.74 g/molN-Methyl moxifloxacin hydrochloride
CAS:N-Methyl moxifloxacin hydrochloride is an analog of the fluoroquinolone antibiotic, Moxifloxacin. It functions as a potent inhibitor of human kinases and has shown promising anticancer activity in preclinical studies. N-Methyl moxifloxacin hydrochloride has been shown to inhibit the growth of tumor cells and induce apoptosis in cancer cells. This drug also exhibits inhibitory effects against linezolid-resistant strains of staphylococcus aureus and has synergistic effects when combined with artesunate, an antimalarial drug. N-Methyl moxifloxacin hydrochloride is excreted primarily through urine and is well-tolerated in Chinese patients.
Formula:C22H27ClFN3O4Purity:Min. 95%Molecular weight:451.9 g/molKRIBB 11
CAS:KRIBB 11 is a potent inhibitor of protein synthesis that blocks translation initiation by binding to the 40S ribosomal subunit. KRIBB 11 has been shown to induce autophagy in vitro and in vivo and inhibit the proliferation of cancer cells. The compound has also been shown to be active against endometriosis, a condition where tissue from the lining of the uterus grows outside the uterus, and tuberculosis. It targets proteins involved in cancer cell survival such as Mcl-1 and Vivo human activated protein kinase (PAK).Formula:C13H12N6O2Purity:Min. 95%Molecular weight:284.27 g/molGHRF, rat
CAS:Stimulates somatotropin releaseFormula:C225H361N77O66SPurity:Min. 95%Color and Shape:PowderMolecular weight:5,232.82 g/molSB 204741
CAS:SB 204741 is a drug that blocks the action of serotonin receptors. It is used in the treatment of autoimmune diseases, such as multiple sclerosis and systemic lupus erythematosus. SB 204741 has been shown to reduce levels of cytosolic calcium, which may be due to its inhibition of phospholipase C. This drug also inhibits the polymerase chain reaction and slows cardiac muscle cell growth. In addition, it inhibits the release of growth factor-β1 from platelets and 5-hydroxytryptamine (5-HT) from synaptosomes in rat brain cells. SB 204741 also has a synergistic effect with detrusor muscle relaxants and potentiates the effects of selective 5-HT2C receptor antagonists on 5-HT2B receptors.
Formula:C14H14N4OSPurity:Min. 95%Molecular weight:286.35 g/molo-Desmethyl-o-ethyl albendazole
CAS:Please enquire for more information about o-Desmethyl-o-ethyl albendazole including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C13H17N3O2SPurity:Min. 95%Molecular weight:279.36 g/molBisphenol A-d6 diglycidyl ether
CAS:Bisphenol A-d6 diglycidyl ether is a deuterated form of an epoxy resin prepolymer, which is a vital compound in polymer chemistry and materials science. It is synthesized through the glycidylation of deuterated bisphenol A, introducing stable isotopic labeling with six deuterium atoms. This isotopic form retains the structural integrity of Bisphenol A diglycidyl ether but enhances its utility in specific scientific applications.
Formula:C21H24O4Purity:Min. 95%Molecular weight:346.4 g/molOTS186935
CAS:OTS186935 is a small molecule that binds to the MDA-MB-231 breast cancer cell line. The observed effect of this compound on cellular viability is due to apoptotic cell death. OTS186935 induces apoptosis by inhibiting transcriptional regulation and the polymerase chain reaction (PCR). It also inhibits DNA methylation, which is an epigenetic process important for various cellular functions. These findings suggest that OTS186935 may be a potential therapeutic agent in cancer therapy.Formula:C25H26ClN5O2Purity:Min. 95%Molecular weight:464 g/molGLX351322
CAS:GLX351322 is a small molecule drug that blocks the activity of TNF-α, which is a proinflammatory cytokine. The drug has been shown to reduce insulin resistance and improve insulin sensitivity in diabetic patients. GLX351322 also has an anti-inflammatory effect by reducing chronic cough and suppressing cholesterol synthesis in rats. It is a synthetic compound that binds to the response element-binding protein (RBP) and prevents the binding of transcription factors to DNA. This prevents the production of inflammatory cytokines and reactive oxygen species (ROS) by immune cells, which are responsible for synaptic dysfunction and neuronal cell death in Alzheimer's disease patients. GLX351322 has been found to have no adverse effects on healthy subjects after short-term exposure.END>>Formula:C21H25N3O5SPurity:Min. 95%Molecular weight:431.51 g/molBW373U86 dihydrobromide
CAS:BW373U86 dihydrobromide is a peptide that inhibits the interaction of the receptor for epidermal growth factor with its ligands. It can be used to study the function of epidermal growth factor in cells, and as a research tool for studying protein interactions.Formula:C27H39Br2N3O2Purity:Min. 95%Molecular weight:597.4 g/mol2-Bromo-5-fluorobenzyl acetate
CAS:Please enquire for more information about 2-Bromo-5-fluorobenzyl acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C9H8BrFO2Purity:Min. 95%Molecular weight:247.06 g/molFenprostalene
CAS:Fenprostalene is a drug that belongs to the group of polymeric matrix tablets. It is used for the treatment of endometriosis and ovarian activity. Fenprostalene has been shown to inhibit the release of acetylcholine from nerves and can be used to treat Parkinson's disease. Fenprostalene also has an anti-inflammatory effect by inhibiting prostaglandin synthesis, which may be due to its inhibition of acetylcholinesterase activity.Purity:Min. 95%Molecular weight:402.48S-Acebutolol-d7
CAS:Controlled ProductS-Acebutolol-d7 is a medicinal compound that has shown promising results in the treatment of cancer. It is an analog of Acebutolol, a beta-blocker that is commonly used to treat hypertension and arrhythmias. S-Acebutolol-d7 has been found to be an effective inhibitor of protein kinases, which are enzymes that play a key role in the regulation of cell growth and division. This compound induces apoptosis (programmed cell death) in cancer cells and has been shown to inhibit tumor growth in human cancer cell lines. Additionally, S-Acebutolol-d7 has demonstrated anticancer activity by blocking the cell cycle progression and suppressing the activity of inhibitors such as Chinese hamster ovary cells. This compound can be detected in urine samples and may have potential as a novel therapeutic agent for cancer treatment.
Formula:C18H28N2O4Purity:Min. 95%Molecular weight:336.4 g/molCis-asenapine
CAS:Controlled ProductPlease enquire for more information about Cis-asenapine including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C17H16ClNOPurity:Min. 95%Molecular weight:285.8 g/molFlupyrimin-d4
CAS:Flupyrimin-d4 is a potent protein kinase inhibitor that has shown promising results in anticancer research. It is an analog of Flupyrimin, which has been used as a medicinal compound for treating various diseases. Flupyrimin-d4 has been found to induce apoptosis in cancer cells and inhibit the activity of kinases, which are enzymes that play a crucial role in cell signaling pathways. Studies have shown that Flupyrimin-d4 is effective against various types of cancer, including human bladder and lung cancer. This drug can be detected in urine samples, making it a useful tool for monitoring treatment efficacy. The Chinese have also used Flupyrimin-d4 as a traditional medicine for treating tumors. With its potential as an anticancer agent, Flupyrimin-d4 holds promise for the development of novel cancer therapies.
Formula:C13H9ClF3N3OPurity:Min. 95%Molecular weight:315.68 g/molDihydrovitamin K1 diacetate
CAS:Dihydrovitamin K1 diacetate is a medicinal compound with potent anticancer properties. It has been shown to inhibit the growth of human and Chinese cancer cells by inducing apoptosis, or programmed cell death. This compound works by inhibiting the activity of kinases and proteins that are essential for cancer cell survival. Dihydrovitamin K1 diacetate also exhibits inhibitory effects against heparin and chitin, which are known to promote tumor growth. This compound may be used as an inhibitor in cancer research, or as a potential therapeutic agent for the treatment of various types of cancers. Its presence can be detected in urine samples, making it a useful biomarker for monitoring cancer progression and treatment efficacy.Formula:C35H52O4Purity:Min. 95%Molecular weight:536.8 g/molSulfo-cyanine7 NHS ester
CAS:Sulfo-cyanine7 NHS ester is a sulfonated form of the dye, cyanine 7. It is used as a fluorescent probe in live cell imaging experiments. The dye has been shown to have an affinity for protein ligands and can be used as an inhibitor or activator of these proteins. Sulfo-cyanine7 NHS ester is stable at room temperature and can be stored for extended periods of time without significant degradation. The high purity of this product makes it ideal for research purposes.Formula:C41H46KN3O10S2Purity:Min. 95%Molecular weight:844 g/molFuramethrin
CAS:Furamethrin is a medicinal compound that acts as an inhibitor of apoptosis, a process that leads to programmed cell death. It has been shown to inhibit protein kinase activity and disrupt the cell cycle in tumor cells, making it a potential anticancer agent. This Chinese analog of pyrethroid insecticides also has potent inhibitory effects on cancer cell growth and proliferation. Furamethrin is excreted primarily in urine and has been found to be effective against various types of cancer in human studies. This compound holds promise as a potential inhibitor for the treatment and prevention of cancer.Formula:C18H22O3Purity:Min. 95%Molecular weight:286.4 g/molBenzthiazide-d7
CAS:Please enquire for more information about Benzthiazide-d7 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C15H14ClN3O4S3Purity:Min. 95%Molecular weight:439 g/molBriciclib disodium
CAS:Briciclib disodium is a prodrug that is administered in the form of a tablet. It is used as an antineoplastic agent to treat cancer. Briciclib disodium is an analog of benzyl bromide, which is a diagnostic agent and has been used in the past to study translation and profiles. This drug can be detected in body fluids such as urine, serum, or plasma. Briciclib disodium has been shown to have potential anti-neoplastic properties and can be used for the treatment of cavity or cancer.
Formula:C19H21Na2O10PSPurity:Min. 95%Molecular weight:518.4 g/mol4-Pentadecylbenzylphosphonic acid
CAS:4-Pentadecylbenzylphosphonic acid is a cell permeant inhibitor of the antibody response, which can be used as a research tool for studying the function of antibodies. It can also be used to study the effects of peptides on receptor-mediated signal transduction pathways. 4-Pentadecylbenzylphosphonic acid binds to anionic phospholipids and blocks calcium ion channels by binding to their ligand binding site. This inhibits the release of neurotransmitters and slows down nerve impulses, which may help in treating pain and epilepsy.Formula:C22H39O3PPurity:Min. 95%Molecular weight:382.5 g/mol4-Methyl-N-(4-nitrophenyl)-1-piperazineacetamide
CAS:Please enquire for more information about 4-Methyl-N-(4-nitrophenyl)-1-piperazineacetamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C13H18N4O3Purity:Min. 95%Molecular weight:278.31 g/molRufinamide-5-carboxamide
CAS:Please enquire for more information about Rufinamide-5-carboxamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H8F2N4OPurity:Min. 95%Molecular weight:238.19 g/molSARS-CoV-2 Spike glycoprotein trimeric ectodomain - from mammalian CHO cells
In order to to penetrate human cells, the SARS-CoV-2 coronavirus needs to dock with the host cell surface via one of its surface proteins, the so-called spike protein. This trimeric protein binds to the ACE2 receptor of human cells and enters the cell through the cell membrane. The spike glycoprotein is therefore considered to be a key target for urgently needed vaccines, antibodies and diagnostics.Purity:Min. 95%X5050
CAS:X5050 is a Chinese medicinal product that has been found to have potent anticancer properties. It is an inhibitor of protein kinases, which are enzymes that play a crucial role in the growth and survival of cancer cells. X5050 has been shown to induce apoptosis, or programmed cell death, in cancer cells, leading to the suppression of tumor growth. This product has also been found to be effective against various types of cancer, including breast cancer and lung cancer. X5050 is an analog of a natural compound found in human urine and has been extensively studied for its medicinal properties. Its unique mechanism of action makes it a promising candidate for the development of new anticancer drugs.
Formula:C17H15N3O3Purity:Min. 95%Molecular weight:309.32 g/molSBC-115076
CAS:SBC-115076 is a monoclonal antibody that binds to the tumor necrosis factor-α (TNF-α) receptor and blocks TNF-α signaling. This drug has been shown to be effective in treating cardiac disease, malignant brain tumors, and atherosclerotic cardiovascular disease. The SBC-115076 antibody is activated by TNF-α, which is released from cells of the immune system or cancer cells. The SBC-115076 antibody prevents TNF-α from binding to its receptor on the surface of other cells and thus prevents activation of those cells. This drug has also been shown to be effective in inhibiting growth of cultured cells, such as cancer cells.Formula:C31H33N3O5Purity:Min. 95%Molecular weight:527.61 g/molMS049
CAS:MS049 is an inorganic compound that is used for the treatment of cancer. It is a basic protein and has been shown to bind to DNA-bound proteins and to regulate gene expression. MS049 binds specifically to methyltransferases, which are enzymes that regulate the methylation of arginine residues in proteins. These methylation changes can have a regulatory effect on the cell cycle, leading to apoptosis or cellular differentiation. MS049 has also been shown to be effective against cardiovascular diseases and carcinoma cells.Formula:C15H24N2OPurity:Min. 95%Molecular weight:248.36 g/molML-213
CAS:ML-213 is a cationic, non-selective drug that is membrane hyperpolarizing. It has been shown to increase the intracellular Ca2+ concentration in cells and to inhibit the growth of human liver, bladder, and mesenteric cells. ML-213 also exhibits selective activities against human lung cancer cells in vitro. It binds to DNA polymerase, preventing transcription and replication. This drug also inhibits the activity of protein kinases by binding to their ATP binding site. The conformational properties of ML-213 have been studied using NMR spectroscopy and found to be affected by alcohol exposure.
Formula:C17H23NOPurity:Min. 95%Molecular weight:257.37 g/mol(2R)-N-[4-[2-[(4-Morpholin-4-ylphenyl)amino]pyrimidin-4-yl]phenyl]pyrrolidine-2-carboxamide
CAS:(2R)-N-[4-[2-[(4-Morpholin-4-ylphenyl)amino]pyrimidin-4-yl]phenyl]pyrrolidine-2-carboxamide is a small molecule inhibitor, which is synthetically derived and designed to interfere with specific protein kinase pathways that are crucial for cancer cell proliferation. The compound exerts its effect by targeting and inhibiting the activity of a distinct set of kinases, thereby disrupting downstream signaling pathways essential for tumor growth and survival.Formula:C25H28N6O2Purity:Min. 95%Molecular weight:444.5 g/mol3-Methoxy limaprost
CAS:3-Methoxy limaprost is a potent inhibitor of kinases, which are enzymes that play a critical role in regulating cellular processes such as protein synthesis and cell division. This inhibitor has been shown to be effective against cancer cells in vitro and in vivo. 3-Methoxy limaprost is an analog of limaprost, which is used as a medicinal drug to treat various diseases including cancer. This compound induces apoptosis (cell death) in human cancer cells by inhibiting the activity of kinases. It has also been found to inhibit the growth of tumors in Chinese hamsters and Balb/c mice. Additionally, 3-Methoxy limaprost has potential anticancer effects on urine-based cancers, suggesting its broad spectrum of anticancer activity.Formula:C23H40O6Purity:Min. 95%Molecular weight:412.6 g/molLY 2886721 hydrochloride
CAS:Cell permeable inhibitor of human β-secretaseFormula:C18H16F2N4O2S•HClPurity:Min. 95%Molecular weight:426.87 g/molEtriciguat
CAS:Etriciguat is a conjugate of guanylate, which is a reactive functional group. It is soluble and degradable, and can be reconstituted in water. Etriciguat stimulates the production of cyclic GMP (cGMP), which has been shown to be effective in treating pulmonary hypertension. Etriciguat has been shown to have diagnostic properties by reacting with a biocompatible fluorescent dye that reacts with cGMP. This reaction causes the emission of light at 615 nm when excited at 340 nm. Etriciguat also has pharmaceutical preparation properties as it can be diluted in an appropriate diluent for intravenous use.Formula:C22H16FN7Purity:Min. 95%Molecular weight:397.4 g/molBiphalin trifluoroacetate salt
CAS:Biphalin trifluoroacetate salt is a research tool for the study of ion channels and ligand-receptor interactions. It is used in pharmacology to study the function of ion channels and ligand-receptor interactions. Biphalin trifluoroacetate salt also has a high purity, which makes it suitable for use in life science research. The biphalin molecule can be used as an activator or an antibody to activate certain receptors.
Formula:C46H56N10O10·C2HF3O2Purity:Min. 95%Rn 9893 hydrochloride
CAS:Rn 9893 hydrochloride is an inhibitor that has shown promising results in the treatment of cancer. It works by targeting elastin, a protein that is highly expressed in cancer cells and plays a role in tumor growth and metastasis. Rn 9893 hydrochloride induces apoptosis, or programmed cell death, in cancer cells and has been found to be effective against various types of tumors. This medicinal compound acts as a kinase inhibitor, preventing the activation of proteins that are involved in cell cycle regulation and promoting cancer cell survival. Rn 9893 hydrochloride has been tested on Chinese hamster ovary cells and human urine samples with positive results, making it a potential candidate for future anticancer therapies.Formula:C21H24ClF3N4O5SPurity:Min. 95%Molecular weight:537 g/mol1-(8Z-Pentadecenoyl)-rac-glycerol
CAS:1-(8Z-Pentadecenoyl)-rac-glycerol is an olefinic lipid that has a hydrophobic acyl chain. The 1-(8Z-pentadecenoyl) group is attached to the glycerol molecule through esterification. This lipid has been used to study the structural and functional effects of different acyl chains on lipids, as well as the effects of lipids on cellular morphology and function. It is also used in reconstituted systems to study lipid processing and its relationship with membrane function.Formula:C18H34O4Purity:Min. 95%Molecular weight:314.46 g/molVU 0365114
CAS:VU 0365114 is a novel compound that is synthesized to act as an allosteric modulator of the acetylcholine receptor. It has been shown to have antagonistic properties at the receptor subtype. VU 0365114 has been found to be active in knockout mice, and it was able to produce effects in the ventral tegmental area and substantia nigra. The drug was also able to increase phosphatidyl fumarate levels, which may be due to its ability to inhibit fumarate reductase activity.
Formula:C22H14F3NO3Purity:Min. 95%Molecular weight:397.35 g/molD-(-)-Amethopterin hydrate
CAS:D-(-)-Amethopterin hydrate is an analog of methotrexate, a chemotherapy drug used to treat cancer. It is a potent inhibitor of dihydrofolate reductase, an enzyme involved in the synthesis of DNA, RNA and proteins. D-(-)-Amethopterin hydrate has been shown to induce apoptosis in cancer cells by inhibiting the activity of kinases that regulate cell growth and survival. This drug has also demonstrated anti-tumor activity in human cancer cell lines and Chinese hamster ovary cells. Additionally, D-(-)-Amethopterin hydrate has been found to enhance the activity of rifampicin, an antibiotic used to treat tuberculosis. Its potential as a therapeutic agent for cancer treatment makes it a promising candidate for further research and development.Formula:C20H22N8O5Purity:Min. 95%Molecular weight:454.4 g/molDeschloro-4-chloro clomiphene hydrochloride
CAS:Please enquire for more information about Deschloro-4-chloro clomiphene hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C26H29Cl2NOPurity:Min. 95%Molecular weight:442.4 g/molProparacaine hydrochloride
CAS:Controlled ProductInhibitor of voltage-gated sodium channelsFormula:C16H27ClN2O3Purity:Min. 95%Molecular weight:330.85 g/mol28-Acetylbetulin
CAS:Controlled Product28-Acetylbetulin is a medicinal compound derived from Chinese herbs that has shown potential as an anticancer agent. It acts as a kinase inhibitor, blocking the activity of proteins that promote cancer cell growth and proliferation. Studies have shown that 28-Acetylbetulin induces apoptosis in human cancer cells, leading to their death. This analog has also been found to be effective against tumors in animal models, making it a promising candidate for further research into cancer treatment. Additionally, it has been reported that 28-Acetylbetulin can be detected in urine after administration, suggesting its potential for use as a diagnostic tool for cancer patients. Overall, this compound represents a promising avenue for the development of new cancer therapies and diagnostic tools.
Formula:C32H52O3Purity:Min. 95%Molecular weight:484.8 g/molVardenafil N-oxide
CAS:Vardenafil N-oxide is a medicinal compound that is an analog of vardenafil, a drug used to treat erectile dysfunction. This compound has been identified as a potential anticancer agent due to its ability to inhibit the activity of certain kinases involved in tumor growth and survival. Vardenafil N-oxide has been shown to induce apoptosis (cell death) in cancer cells, particularly those of Chinese hamster ovary origin. Additionally, this compound has demonstrated inhibitory effects on the growth of human prostate cancer cells and has been found in the urine of patients undergoing treatment with cysteamine, a medication used for the treatment of cystinosis. Overall, Vardenafil N-oxide holds significant promise for the development of novel cancer therapies as an inhibitor of key signaling pathways involved in tumor progression.Formula:C23H32N6O5SPurity:Min. 95%Molecular weight:504.6 g/molVU 152100
CAS:VU 152100 is a novel non-peptide, small molecule that blocks the protein synthesis of neurotransmitters by targeting the enzyme protein kinase A (PKA). VU 152100 binds to PKA, inhibiting its activity and blocking the production of neurotransmitters. This drug has been shown to have effects on locomotor activity and symptoms in mice. VU 152100 also has a cholinergic activity, which may be due to its ability to inhibit acetylcholine release.Formula:C18H19N3O2SPurity:Min. 95%Molecular weight:341.43 g/mol
