Biochemicals and Reagents

IMM-01 is a molecule that has been shown to stabilize actin filaments and prevent the disruption of cellular cytoskeletal structures. It has been shown to inhibit tumor growth in xenograft tumor models and to elicit an antibody response in mice when used as an immunization. IMM-01 is also able to induce cytotoxic T cells and natural killer cells, which may be due to its ability to stabilize actin filaments.
IMM-01 is currently being investigated for potential use in cancer therapy and industrial processes, such as the production of antibodies.

A synthetic peptide for use as a blocking control in assays to test for specificity of GSTM2 antibody, catalog no. 70R-2848

HCN3 antibody was raised using the middle region of HCN3 corresponding to a region with amino acids LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. Specifically designed to combat tuberculosis infection, this compound exhibits strong bactericidal activity. It works by binding to DNA-dependent RNA polymerase, effectively inhibiting bacterial growth and preventing transcription and replication. Through various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, the active form of this drug is metabolized. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

L-Alpha-methyl dopa dimethyl ether hydrochloride is a medicinal compound that acts as an inhibitor of protein kinases in human cells. This compound has been shown to induce apoptosis, or programmed cell death, in various types of cancer cells, including leukemia and tumors. L-Alpha-methyl dopa dimethyl ether hydrochloride is a potent anticancer agent that inhibits the cell cycle and promotes tumor suppression. It has been used in Chinese medicine for its ability to inhibit the growth of cancer cells and has also been found in urine samples of patients with certain types of cancer. This compound shows promising potential as a therapeutic agent for the treatment of cancer.

XL888 is a selective and potent inhibitor of heat shock protein 90 (HSP90), which is a molecular chaperone involved in the proper folding, stability, and function of many client proteins, including those critical in cancer progression. Sourced from rigorous medicinal chemistry processes, XL888 is designed to bind to the ATP-binding site of HSP90, thereby inhibiting its chaperone activity. This inhibition leads to the degradation of client proteins that are essential for tumor growth and survival.

Rabbit polyclonal TYMS antibody

E.coli-derived,-17.2 kDa-Recombinant-Murine IL-2.

NCX 1000 is a guanylate cyclase activator that has been shown to be effective in the treatment of symptoms of overactive bladder. It is a soluble guanylate cyclase activator that increases the sensitivity of the receptor site, leading to increased intracellular levels of cGMP. NCX 1000 has been shown to be an effective treatment for overactive bladder and can be used in conjunction with other drugs such as gabapentin or noradrenaline. NCX 1000 also has numerous other effects including increasing reaction time and improving muscle function. The experimental model for this drug is detrusor muscle from rats treated with carbon tetrachloride or sodium channel modulators, which are known to cause bladder dysfunction.

ACAA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Rabbit polyclonal UBXN4 antibody

IL 21 Mouse is a recombinant protein that belongs to the IL-21 family and is used as a research tool in cell biology and pharmacology. It is an activator of IL-21 receptor, which plays an important role in the immune system. The protein has been shown to promote T-cell proliferation, differentiation, and cytokine production. It binds to the IL-21 receptor and activates it by inducing a conformational change in the receptor. This binding induces activation of signaling pathways such as phosphoinositide 3-kinase (PI3K) or extracellular signal-regulated kinases 1/2 (ERK1/2).
IL 21 Mouse can be used for studying protein interactions, peptides, and antibodies.

Please enquire for more information about (S)-1-Aminoindane-d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Purified recombinant GNRH1 protein (His tag)

LRRC8B antibody was raised using the N terminal of LRRC8B corresponding to a region with amino acids PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS

18-Deoxyherboxidiene is a potent inhibitor of kinases, making it an effective anticancer agent. It works by inhibiting the activity of certain proteins that are involved in cancer cell growth and proliferation. This compound has been found to induce apoptosis in cancer cells, leading to their death. 18-Deoxyherboxidiene is a medicinal analog of Herboxidiene, which was originally isolated from a Chinese soil sample. It has shown promising results in preclinical studies as a potential treatment for various types of cancer. In addition, this compound has been detected in human urine samples, indicating its potential for use as a diagnostic tool for cancer detection and monitoring. Its unique properties make it a valuable tool for further research into the development of new cancer treatments.

The TRIM14 antibody is a highly effective antiviral agent that belongs to the class of monoclonal antibodies. It acts as an inhibitor of protein kinase and growth factor signaling pathways, preventing viral replication and spread. This antibody also has metal-binding properties, which contribute to its neutralizing activity against viruses. In addition, it enhances the activity of phosphatases and interferon, further boosting the immune response against viral infections. The TRIM14 antibody is available in both monoclonal and polyclonal forms, offering a wide range of options for researchers in the field of Life Sciences. Its high specificity ensures minimal cross-reactivity with other proteins, making it a valuable tool for studying virus-host interactions. With its ability to induce lysis of infected cells and neutralize viruses in human serum, this antibody holds great promise in the development of antiviral therapies.

PI3K and mTOR enzyme inhibitor; anti-cancer agent

M1001 is a biochemical reagent, which is synthesized through advanced organic chemistry techniques, with a specific mode of action that targets nucleic acid structures. It functions as an intercalating agent, inserting itself between base pairs in DNA strands. This interaction alters DNA topology, making M1001 invaluable for research applications that involve DNA replication, transcription, and repair studies.

GW 803430 is a selective 5-HT2C receptor antagonist that has been shown to have an anti-obesity effect. It has also been found to be efficacious in animal models of chronic alcohol consumption, which may be due to its ability to inhibit the serotonergic system and increase locomotor activity. GW 803430 inhibits the binding of serotonin and dopamine receptors in rats, making it an excellent candidate for pharmacological treatment.

GSK2033 is a chemical compound that acts as a liver X receptor (LXR) antagonist, primarily sourced from synthetic origins. It functions by binding to the LXR, which is a nuclear receptor involved in regulating the expression of genes controlling lipid metabolism and cholesterol homeostasis. By inhibiting the activation of LXR, GSK2033 decreases lipid and cholesterol synthesis pathways, thereby modulating lipid levels within cells.

BPD 9066 is a small-molecule inhibitor of the DNA methyltransferase enzyme, which is involved in gene expression profiles. BPD 9066 has been shown to have anti-cancer effects in mice with alveolar cell carcinoma. This drug also has an effect on muscle cells by preventing them from converting carbon sources into energy, which may be due to its ability to inhibit the activity of xylan synthase. BPD 9066 also inhibits the growth and proliferation of human papillomavirus (HPV), but does not affect the virus's infectivity.

NP1 antibody was raised in goat using highly pure recombinant human NP-1 as the immunogen.

The WDFY3 antibody is a highly valuable product in the field of Life Sciences. It is a Polyclonal Antibody that plays a crucial role as a biomarker composition. This antibody specifically targets cation channels and interleukins, making it an essential tool for researchers studying these areas.

Ritipenem is a cationic peptide antibiotic with an antimicrobial spectrum similar to that of the penem group. It binds to the cytoplasmic membrane of Gram-negative bacteria, forming ion channels and leading to an increase in membrane permeability and cell death. Ritipenem has been shown to inhibit protein interactions, ligand binding and receptor activation by other agonists, as well as having affinity for a wide range of peptides. The purity of this compound is high, with no detectable traces of contaminants such as endotoxins or proteases. Ritipenem also has been shown to have antibacterial activity against Mycobacterium tuberculosis and other mycobacteria.