Biochemicals and Reagents

<p>Protease free Bovine Serum Albumin</p>

<p>CA 19-9 (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 19-9 (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>West Nile Virus Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about West Nile Virus Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-Gly-Trp-Gly-OH is a useful scaffold, versatile building block, and reaction component in organic synthesis. It is a high quality reagent that can be used as a useful building block or intermediate in the synthesis of complex compounds. H-Gly-Trp-Gly-OH is also available for research purposes.</p>

<p>Oropouche virus (OROV) is an arthropod-borne orthobunyavirus found in South America, originally isolated in Trinidad and Tobago. The virus is transmitted by Culicoides paraensis mosquitoes, which feed on vertebrate hosts, including humans. It causes Oropouche fever, a febrile infection similar to dengue. The nucleocapsid protein (N) is encoded by OROV’s small genome segment. It plays a crucial role in genome encapsidation, protecting viral RNA from degradation, as well as facilitating viral RNA synthesis and viral particle assembly. Detecting OROV in diagnostic assays is vital due to its potential to cause large epidemics. This mouse monoclonal antibody for detection of full length Oropouche virus nucleocapsid protein.Cymit Quimica's mouse monoclonal antibodies to Oropouche Virus Nucleoprotein were raised using recombinant Oropouche protein, strain TRVL9760, as immunogen. We offer five different clones allowing customers the flexibility to mix and match to determine the optimum co-operative pair for detection of Oropouche nucleoprotein in their assay system.</p>

<p>Dengue virus is a member of the Flaviviridae family and is responsible for causing dengue fever in humans. It is transmitted to humans primarily via the Aedes aegypti and Aedes albopicto female mosquitoes which acquire the virus while feeding on the blood of an infected person. Although this virus can inflict asymptomatic or mild symptoms in patients, it can lead to severe infectious such as dengue hemorrhagic fever, also known as dengue shock syndrome.<br>The Dengue Virus non-structural protein 1 (NS1) is an important glycoprotein antigen in Dengue viral replication and is secreted from infected host cells as a hexamer. As a secreted hexamer the NS1 protein contains a detergent-sensitive central cavity, hosting around 70 lipid molecules which may allow the NS1 to interact with cell surface glycosaminoglycans and to attach to the cell membranes of the host cells. Once the NS1 is anchored into the surface membrane of infected host cells it appears as a membrane associated homodimer. It is believed that NS1 may interact with complement proteins leading to protection of the Dengue virus from complement-dependent lysis and furthermore may be involved in systemic immunity and contribute to vascular leakage, coagulopathy and thromobocytopenia.<br>The global prevalence of dengue fever is significant and while there are numerous diagnostic tests on the market at present for dengue virus, there are few flavivirus panel assays and no specific dengue virus therapeutics available. Cymit Quimica’s biologics division is leading the field in the development of these target recombinant proteins and monoclonal antibodies. Our range of Dengue virus proteins and antibodies provides global development teams and researchers with access to vital and new raw material to test samples, in the race to diagnose patients earlier and help with vaccine development. We offer dengue virus proteins including envelope and NS1 from serotypes 1-4 and dengue virus monoclonal antibodies, for research and diagnostic purposes.</p>

<p>5-Fluoro-1-(tetrahydro-2-furyl)uracil is a chemotherapeutic agent, which is a synthetic derivative of uracil. This compound is developed from modified nucleosides with the aim of enhancing antitumor efficacy. Its mechanism of action involves the inhibition of thymidylate synthase, leading to a disruption in DNA synthesis. By integrating into RNA and DNA, it ultimately impedes tumor cell proliferation due to RNA processing interference and DNA damage.</p>

<p>The Calcitonin antibody is a powerful cytotoxic agent that targets TGF-beta1, an important growth factor involved in various physiological processes. This antibody can be used in research and diagnostic applications to detect and quantify TGF-beta1 levels. It works by binding specifically to the target molecule, allowing for accurate measurement and analysis. Additionally, this monoclonal antibody has been shown to have anti-ganglioside activity, making it useful in studies related to glycan-mediated processes. Its high specificity and reactivity make it an invaluable tool in the field of Life Sciences.</p>

<p>H-TGGILAAPVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TGGILAAPVR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TGGILAAPVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TGGILAAPVR-OH at the technical inquiry form on this page</p>

<p>Purified native Human Myoglobin protein (Cardiac)</p>

<p>Please enquire for more information about Leishmania IgG Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-LCSGSR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LCSGSR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LCSGSR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LCSGSR-OH at the technical inquiry form on this page</p>

<p>H-KRLRLIHLL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRLRLIHLL-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRLRLIHLL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRLRLIHLL-OH at the technical inquiry form on this page</p>

<p>Goat anti-rat IgG/IgA/IgM (H+L) was raised in goat using rat IgG, IgA and IgM whole molecules as the immunogen.</p>

<p>Agonist of FP prostaglandin receptor, EP1 and EP3 prostaglandin receptors</p>

<p>Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal HLA-B7 antibody</p>

<p>Ruboxistaurin mesylate is a synthetic small-molecule inhibitor, which is derived from pharmaceutical research. It functions as a specific inhibitor of protein kinase C beta (PKC-β), a key enzyme implicated in the pathological processes of diabetic retinopathy. The compound's mechanism of action involves blocking the diacylglycerol-mediated activation of PKC-β, thereby mitigating the abnormal signaling pathways that contribute to retinal damage in diabetes.</p>

<p>H-VQGKDWGFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VQGKDWGFK-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VQGKDWGFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VQGKDWGFK-OH at the technical inquiry form on this page</p>

<p>Activator of SIRT1 deacetylase</p>

<p>Goat anti Human IgG antibody was raised in goat using human IgG F(c) fragment as the immunogen.</p>

<p>Peptide H-VSAQQVQGVHAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>29-227 amino acids: MLPICPGGAA RCQVTLRDLF DRAVVLSHYI HNLSSEMFSE FDKRYTHGRG FITKAINSCH TSSLATPEDK EQAQQMNQKD FLSLIVSILR SWNEPLYHLV TEVRGMQEAP EAILSKAVEI EEQTKRLLEG MELIVSQVHP ETKENEIYPV WSGLPSLQMA DEESRLSAYY NLLHCLRRDS    HKIDNYLKLL KCRIIHNNNC</p>

<p>Complement Component 4c (C4c), Highly Purified (Liquid) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Complement Component 4c (C4c), Highly Purified (Liquid) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Chlamydia antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and detect Chlamydia, a common sexually transmitted infection. This antibody has been extensively tested and proven to have high specificity and sensitivity in detecting Chlamydia antigens in various samples. It works by binding to specific proteins expressed by the Chlamydia bacteria, allowing for accurate identification and diagnosis of the infection.</p>

<p>The Vancomycin antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to mesothelin, an antigen expressed on the surface of certain cancer cells. This antibody has been extensively studied and proven to be effective in inhibiting the growth and spread of cancer cells by blocking the interaction between mesothelin and its receptor. In addition to its anti-cancer properties, the Vancomycin antibody has also shown potential in other therapeutic applications, such as targeted drug delivery and imaging. Its unique binding characteristics make it a valuable tool for researchers and clinicians working in various fields of study, including oncology, immunology, and drug development.</p>

<p>Spironolactone is an aldosterone receptor antagonist that is used to treat hypertension, heart failure and edema. This drug binds to mineralocorticoid receptors and acts as an aldosterone antagonist. Spironolactone promotes sodium and water excretion and potassium retention. It also activates pro-inflammatory pathways.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about S7958 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-SANYETDPFVQEFQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-CVELFLADVEGLSVLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CVELFLADVEGLSVLR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CVELFLADVEGLSVLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CVELFLADVEGLSVLR-OH at the technical inquiry form on this page</p>

<p>Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified Chicken IgG FITC conjugate</p>

<p>Goat anti-Human IgA antibody</p>

<p>Inhibitor of cathepsin K inhibitor; reduces bone resorption</p>

<p>Peptide H-LGSSEVEQVQLVVDGVK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPFPIIV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CD45RO antibody was raised in mouse using T cells from an IL 2 dependent T Cell line (CA-1) as the immunogen.</p>

<p>Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.</p>

<p>Peptide H-VFSVSLSNPSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LTWASHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lamotrigine is an antiepileptic phenyltriazine drug that is used to treat epilepsy and as a mood stabilizer in bipolar disorder. Although, this drug’s action is not fully well understood it is similar to carbamazepine which involves inhibiting voltage-sensitive sodium channels. Lamotrigine blocks voltage-sensitive sodium channels, which reduces neuronal excitability by blocking action potentials.</p>

<p>Complement C1q protein is a vital component of the complement system, which is an integral part of the immune response. This protein plays a crucial role in the recognition and clearance of pathogens and damaged cells. Complement C1q protein binds to antibodies that have attached to foreign substances, leading to the activation of the complement cascade. This activation triggers a series of events that result in cell lysis, neutralization of pathogens, and promotion of inflammation. Additionally, Complement C1q protein has been found to interact with various growth factors such as epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta), modulating their activity. It also participates in collagen synthesis and interacts with other proteins like anti-ACTH antibodies and trastuzumab. With its multifaceted functions, Complement C1q protein plays a pivotal role in maintaining immune homeostasis and defending against infections and diseases.</p>

<p>IL33 antibody was raised in mouse using recombinant human IL-33 (112-270aa) purified from E. coli as the immunogen.</p>

<p>Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The THC antibody is a monoclonal antibody that acts as an inhibitor against the growth factor angptl3. It belongs to the class of antibodies and is specifically designed to neutralize the effects of angptl3. This antibody has been widely used in Life Sciences research and has shown promising results in treating conditions such as thrombocytopenia and alpha-fetoprotein-related disorders. The colloidal nature of this monoclonal antibody allows for easy delivery and precise targeting. Additionally, it has been found to have high affinity towards angptl3, making it an effective tool for studying the role of this growth factor in various biological processes. With its potent inhibitory properties and ability to bind to specific targets, the THC antibody is a valuable asset in biomedical research.</p>

<p>H-KQLLHGEPNVSYICSRY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KQLLHGEPNVSYICSRY-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KQLLHGEPNVSYICSRY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KQLLHGEPNVSYICSRY-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-CSKTKERRNRMEVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-VGETYGKDITSRGKDKPIA-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-VGETYGKDITSRGKDKPIA-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-VGETYGKDITSRGKDKPIA-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-VGETYGKDITSRGKDKPIA-NH2 at the technical inquiry form on this page</p>

<p>The GATA1 antibody is a polyclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to GATA1, a protein involved in the regulation of gene expression during development. This antibody has been shown to be reactive with human serum and can be used for various applications such as immunohistochemistry, Western blotting, and ELISA. The GATA1 antibody is highly specific and sensitive, making it an essential tool for researchers studying the role of GATA1 in various biological processes. Its high affinity for the target protein ensures accurate and reliable results. Whether you are conducting basic research or working on a diagnostic project, the GATA1 antibody is an invaluable tool that will help you advance your scientific endeavors.</p>

<p>Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AHIFDLAINK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Antagonist of GluK1 kainate receptor</p>

<p>H-WVDGTDYETGFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WVDGTDYETGFK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WVDGTDYETGFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WVDGTDYETGFK-OH at the technical inquiry form on this page</p>

<p>H-LQVISLE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LQVISLE-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LQVISLE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LQVISLE-OH at the technical inquiry form on this page</p>

<p>Inhibitor of Rho-kinases</p>

<p>Please enquire for more information about Chlamydia Trachomatis MOMP Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peptide H-IGSEAYNQQLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH</p>

<p>Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-QQRFEWEFEQQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Alpha tubulin antibody was raised in mouse using alpha-tubulin isolated from chick brain microtubules as the immunogen.</p>

<p>Peptide H-HNLFEPEDTGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-YAPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Levosimendan has been shown to act as a calcium sensitiser and increase cytosolic Ca2+ levels. It is an analog of the cardiac glycoside, ouabain. This drug has been shown to be effective for the treatment of congestive heart failure and is used to increase the heart’s contractility and decrease its rate in patients who have low cardiac output. Levosimendan also causes vasodilation by increasing nitric oxide production in vascular endothelial cells.</p>

<p>Potent inhibitor of c-Met catalytic activity. Selective over other tyrosine and serine-threonine kinases (600-fold selectivity). Ability to block constitutive or HGF-stimulated phosphorylation of c-Met demonstrated in vitro. JNJ 38877605 reduces radiation-induced invasion, apoptosis and proliferation of cancer cells in vitro.</p>

<p>Inhibits p38 MAPK and blocks self-renewal of cancer stem cells</p>

<p>Peptide H-GNDVAFHFNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Tau antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Tau protein, which plays a crucial role in the formation of neurofibrillary tangles found in neurodegenerative diseases such as Alzheimer's disease. By binding to Tau protein, the antibody can effectively inhibit its aggregation and promote the clearance of existing tangles.</p>

<p>pE-MAVKKYLNSILN-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>H-TYVDPFTYEDPNQAVC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TYVDPFTYEDPNQAVC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TYVDPFTYEDPNQAVC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TYVDPFTYEDPNQAVC-OH at the technical inquiry form on this page</p>

<p>Peptide H-SVFDQDPFLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Luciferase antibody was raised in goat using highly purified firefly luciferase as the immunogen.</p>

<p>pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YGNGVWIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified recombinant Human S100A2 protein</p>

<p>Peptide H-QLSESQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ferritin antibody was raised in goat using ferritin from the human Liver as the immunogen.</p>

<p>Measles Virus Antibody Negative Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Measles Virus Antibody Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-EIDTVLPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>IgG Myeloma Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IgG Myeloma Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Human IgG gamma antibody was raised in sheep using human IgG (Fc Fragment) as the immunogen.</p>

<p>HSV2 gD antibody was raised in mouse using purified HSV from strain BH as the immunogen.</p>

<p>HBE1 antibody was raised in Rabbit using Human HBE1 as the immunogen</p>

<p>Rabbit polyclonal Rabies Virus Glycoprotein G antibody</p>

<p>Normal Goat Serum is a Biospecimen for use in pharmaceutical and diagnostic applications. Please enquire for more information about Normal Goat Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide Ac-CMSGTGIRSVTGTPY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ATPase antibody was raised in rabbit using highly purified Na+, K+ ATPase from rabbit kidney, enzymatically denatured, as the immunogen.</p>

<p>SARS-CoV-2 Nucleocapsid Antigen (UK Variant – B.1.1.7), Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-2 Nucleocapsid Antigen (UK Variant – B.1.1.7), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>hCG Beta antibody was raised in mouse using hCG beta as the immunogen.</p>

<p>The SARS Coronavirus Antibody is a specific antibody that targets the SARS-CoV virus. It has been extensively tested and proven to bind specifically to the virus, inhibiting its replication and spread. This monoclonal antibody is produced using advanced techniques such as polymerase chain reaction (PCR) and transcription-polymerase chain reaction (RT-PCR). It specifically targets the α subunit of the virus, which is crucial for its survival and replication.</p>

<p>Peptide H-TIAIIAEGIPEALTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Collagen type IV antibody was raised in rabbit using human placenta type IV collagen as the immunogen.</p>

<p>H-HYNPSLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HYNPSLK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HYNPSLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HYNPSLK-OH at the technical inquiry form on this page</p>

<p>Dual inhibitor of thromboxane receptor and DP2 postanoid receptor</p>

<p>Peptide H-SQIFSTASDNQPTVTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Rabbit anti-Human IgG4 monoclonal antibody</p>

<p>H-NAPPEPVPPPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Prolactin antibody was raised in mouse using purified human prolactin as the immunogen.</p>

<p>8-Chloro-4-(4-(3-chlorophenyl)piperazin-1-yl)cinnoline is a research tool that can be used in the study of ion channels and cell biology. It is an inhibitor of potassium channels, which are voltage-gated ion channels involved in the generation and propagation of action potentials. This compound binds to glutamate receptors, which are ligand-gated ion channels that regulate neurotransmitter release. 8-Chloro-4-(4-(3-chlorophenyl)piperazin-1-yl)cinnoline also inhibits peptide binding to its receptor, leading to reduced activity of this protein. 8-Chloro-4-(4-(3-chlorophenyl)piperazin-1-yl)cinnoline has been shown to inhibit the enzyme acetylcholinesterase, which leads to increased levels of acetylcholine in the synapse.</p>

<p>Sheep Red Blood Cells (SRBC) are widely used in various research applications. SRBC contain prodigiosin, a red pigment that can be used as a marker for cell labeling and tracking. They are often used in studies involving messenger RNA (mRNA) analysis, electrophoresis, and the characterization of metal-binding proteins. In veterinary applications, SRBC can be used as an anticoagulant to prevent blood clotting during procedures. Additionally, SRBC have been utilized in studies related to adipose tissue, liver microsomes, midbrain dopaminergic neurons, interferon production, and the development of monoclonal antibodies with neutralizing properties. With their versatility and wide range of applications, SRBC are essential tools in life sciences research.</p>

<p>H-MGLPAAPFLTKIEPSKPAAT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MGLPAAPFLTKIEPSKPAAT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MGLPAAPFLTKIEPSKPAAT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MGLPAAPFLTKIEPSKPAAT-OH at the technical inquiry form on this page</p>

<p>Inhibitor of CSF1R receptor</p>

<p>BRDU antibody was raised in mouse using bromodeoxyuridine as the immunogen.</p>

<p>Influenza B antibody was raised in mouse using Influenza B as the immunogen.</p>

<p>Rabbit anti-mouse IgG2a (FITC) was raised in rabbit using murine IgG2a heavy chain as the immunogen.</p>

<p>Antagonist of NMDA receptor</p>

<p>Peptide H-LVVVGACGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>14.3.3 Sigma antibody (BSA/Azide-free) was raised in mouse using recombinant human 14-3-3 sigma protein as the immunogen.</p>

<p>H-SLPGRTRCA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SLPGRTRCA-OH is provided at greater that &gt;98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SLPGRTRCA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SLPGRTRCA-OH at the technical inquiry form on this page</p>

<p>Gastric proton pump inhibitor</p>

<p>Peptide H-KVLEHVVRV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MDLEKNYPTPRTSRTC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-ATFPLMFYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ATFPLMFYK-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ATFPLMFYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ATFPLMFYK-OH at the technical inquiry form on this page</p>

<p>H-ALKPGVIQILGVK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALKPGVIQILGVK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALKPGVIQILGVK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALKPGVIQILGVK-OH at the technical inquiry form on this page</p>

<p>Selective serotonin reuptake inhibitor; anti-depressant</p>

<p>Peptide LCBiot-VHWDFRQWWQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Control Normal Donkey Serum filtered</p>

<p>Peptide H-FL^GYLILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-RGSQSYVPL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RGSQSYVPL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RGSQSYVPL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RGSQSYVPL-OH at the technical inquiry form on this page</p>

<p>Peptide H-GFPGIQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VPQVSTPTLVEVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPLTTPVGGGIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDVFVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ARKSTGGKAPRKQLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PVDEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-PRGVSAYLSRPSPGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PRGVSAYLSRPSPGGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PRGVSAYLSRPSPGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PRGVSAYLSRPSPGGC-OH at the technical inquiry form on this page</p>

<p>H-ASPLPVLNWANR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ASPLPVLNWANR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ASPLPVLNWANR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ASPLPVLNWANR-OH at the technical inquiry form on this page</p>

<p>Peptide H-LTVLGQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ALAAELNQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Human Serum Albumin</p>

<p>Peptide H-VGGHAAEYGAEAL^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclooxygenase inhibitor; NSAID; an opthalmic analgesic</p>

<p>Peptide H-FFEILSPVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ca2+ ATPase antibody was raised in rabbit using N-terminal sequence-specific peptide of the human pump epitope as the immunogen.</p>

<p>Peptide H-LGVAGQWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CRP antibody was raised in goat using Purified human CRP as the immunogen.C-Reactive Protein (CRP) is an acute-phase inflammatory, pentameric plasma protein. Awarded its name after being first discovered reacting with the capsular (C)-polysaccharide of the Pneumococcus infection, CRP has since been found to activate the classical complement pathway of innate immunity. Dependent on the presence of calcium ions on its ligand-binding face, CRP specifically stimulates C1q when binding to phosphocholine and other polysaccharides located on microorganisms. Expression of CRP is increased (primarily in the hepatocytes) when inflammatory cytokines such as interleukin-6 are elevated during infection and some conditions such as rheumatoid arthritis and cardiovascular diseases.</p>

<p>Proinsulin antibody was raised in mouse using human proinsulin as the immunogen.</p>

<p>MLN 4924 is a selective small molecule that acts as an inhibitor of the Nedd8-activating enzyme. This compound is synthetically derived and functions by inhibiting the conjugation of Nedd8 to cullin proteins. By blocking this pathway, MLN 4924 disrupts the activity of the SCF (Skp, Cullin, F-box containing complex) E3 ubiquitin ligase, leading to an accumulation of proteins that can induce apoptosis and cell cycle arrest.</p>

<p>Peptide H-TGSGDIENYNDATQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-SNPVTLNVLYGPDLPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SNPVTLNVLYGPDLPR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SNPVTLNVLYGPDLPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SNPVTLNVLYGPDLPR-OH at the technical inquiry form on this page</p>

<p>Mouse monoclonal Insulin+Proinsulin antibody</p>

<p>Hepatitis A virus antibody was raised in mouse using purified hepatitis A as the immunogen.</p>

<p>Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Eotaxin is a human basic protein that belongs to the eosinophil cationic protein family. It stimulates the growth of cells and promotes tissue repair. Eotaxin also has a role in the immune response, as it is able to bind to and activate macrophages, neutrophils, and lymphocytes. Eotaxin is found in increased concentrations in inflammatory bowel disease (IBD), where it may play a role in the recruitment of inflammatory cells. The signal peptide sequence of eotaxin is cleaved by signal peptidase I and II during transit through the Golgi apparatus, yielding an active form that can be processed into mature eotaxin by several proteases. This active form can be detected by polymerase chain reaction (PCR) amplification of DNA isolated from human peripheral blood leukocytes or colonic biopsies. Eotaxin has been shown to have anti-inflammatory effects on both healthy tissues and those with</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A1 antibody, catalog no. 70R-1754</p>

<p>Peptide H-DLPMSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-PVSLLEKAAPQWC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-PVSLLEKAAPQWC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-PVSLLEKAAPQWC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-PVSLLEKAAPQWC-NH2 at the technical inquiry form on this page</p>

<p>Please enquire for more information about AF488 Maleimide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CMV antibody was raised in mouse using the 65 kDa late major matrix protein of CMV as the immunogen.</p>

<p>H-ALPGQLKPFETLLSQNQGGK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALPGQLKPFETLLSQNQGGK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALPGQLKPFETLLSQNQGGK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALPGQLKPFETLLSQNQGGK-OH at the technical inquiry form on this page</p>