Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,117 products)
- By Biological Target(99,161 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,705 products)
- Secondary Metabolites(14,220 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Rabies antibody
<p>Rabies antibody was raised in mouse using purified rabies virus as the immunogen.</p>Cyfra 21-1 Antigen Negative Human Serum
<p>Please enquire for more information about Cyfra 21-1 Antigen Negative Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>IKB α peptide
<p>Please enquire for more information about IKB alpha peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C114H192N36O41SSyphilis (RPR) Antibody Positive Human Serum
<p>Please enquire for more information about Syphilis (RPR) Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-FLAKSFGSPNRAYKK-OH
<p>Please enquire for more information about H-FLAKSFGSPNRAYKK-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Molecular weight:1,714.02 g/molMycoplasma Pneumoniae IgM Positive Human Serum
<p>Please enquire for more information about Mycoplasma Pneumoniae IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>SARS-CoV-2 Antigen Peptide SPIKE
<p>Peptide H-VVFLHVTYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C54H79N11O11Molecular weight:1,076.29 g/molNT-proBNP Positive Human Li Heparin Plasma/K2 EDTA Plasma Matched Set
<p>Please enquire for more information about NT-proBNP Positive Human Li Heparin Plasma/K2 EDTA Plasma Matched Set including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Toxoplasma Gondii IgM Medium/High Positive Human Plasma
<p>Please enquire for more information about Toxoplasma Gondii IgM Medium/High Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-AITHGPYCSQFNDTLNVYLT-OH
<p>Please enquire for more information about H-AITHGPYCSQFNDTLNVYLT-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Molecular weight:2,257.53 g/molKemptide (Phosphate Acceptor Peptide)
<p>Please enquire for more information about Kemptide (Phosphate Acceptor Peptide) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H59N13O8H-TMLLQPAGSLGSYSYR^-OH
<p>Peptide H-TMLLQPAGSLGSYSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIYKGVYQFKSV-OH
<p>LCMV CD4 epitope peptide GP66–77 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C69H103N15O19Molecular weight:1,446.65 g/molHuman Serum from Patient with Renal Insufficiency
<p>Please enquire for more information about Human Serum from Patient with Renal Insufficiency including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>PSA1 (141-150)
CAS:<p>Peptide H-FLTPKKLQCV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C55H93N13O13SMolecular weight:1,176.47 g/molPIM2tide
<p>Peptide RSRHSSYPAGT is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C50H77N19O16H-LRRLSLGLRRLSLGLRRLSLGLRRLSLG-OH
<p>Please enquire for more information about H-LRRLSLGLRRLSLGLRRLSLGLRRLSLG-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Molecular weight:3,201.98 g/molGsMTx4
CAS:<p>Please enquire for more information about GsMTx4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C185H279N49O45S6Molecular weight:4,101.89 g/molStreptococcus pneumoniae antibody
<p>Streptococcus pneumoniae antibody was raised in rabbit using a whole cell blend of numerous serotypes as the immunogen.</p>Purity:Min. 95%Naturally Allergic IgE Positive Plasma
<p>Please enquire for more information about Naturally Allergic IgE Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-LDDRHDSGLDSMKDEEY-OH
<p>Peptide LDDRHDSGLDSMKDEEY is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:2,025.11 g/molH-PERLGVLASHHDNAAVDASS-OH
<p>Please enquire for more information about H-PERLGVLASHHDNAAVDASS-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Molecular weight:2,046.2 g/molJak3tide
<p>Please enquire for more information about Jak3tide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Molecular weight:1,813 g/molIL6 antibody
<p>The IL6 antibody is a monoclonal antibody that specifically targets interleukin-6 (IL-6), a pro-inflammatory cytokine. IL-6 plays a crucial role in various biological processes, including immune response, inflammation, and cell growth. This antibody works by binding to IL-6 and preventing its interaction with its receptors on the cell surface.</p>Saccharomyces Cerevisiae IgA Positive Human Plasma
<p>Please enquire for more information about Saccharomyces Cerevisiae IgA Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>SS-B Antibody Positive Human Serum
<p>Please enquire for more information about SS-B Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>CMVpp65 - 103 (ELVTTERKTPRVTGG)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,643.9 g/molHuman Growth Hormone (> 60% pure)
<p>Purified native Human Human Growth Hormone (> 60% pure)</p>Purity:Min. 95%CCP Antibody Positive Human Serum
<p>Please enquire for more information about CCP Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>SARS-CoV-2 chain A spike glycoprotein (509-523)
<p>Please enquire for more information about SARS-CoV-2 chain A spike glycoprotein (509-523) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C77H124N20O19Molecular weight:1,651.95 g/molH-EYGGLDVLVNNAGIAFK-OH
<p>H-EYGGLDVLVNNAGIAFK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EYGGLDVLVNNAGIAFK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EYGGLDVLVNNAGIAFK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EYGGLDVLVNNAGIAFK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Casein Kinase II
<p>Peptide RRRDDDSDDD is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C45H73N19O24Molecular weight:1,264.2 g/molEBV IgM Positive Human Serum
<p>Please enquire for more information about EBV IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>CMV IgM Medium Positive Human Plasma
<p>Please enquire for more information about CMV IgM Medium Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Syphilis (RPR) Antibody Positive Human Plasma
<p>Please enquire for more information about Syphilis (RPR) Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Estradiol Positive Human Serum
<p>Please enquire for more information about Estradiol Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>E. Coli Antibody Positive Human Serum
<p>Please enquire for more information about E. Coli Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Human Serum from SARS-CoV-2 (KP.2 Variant) Patient
<p>Please enquire for more information about Human Serum from SARS-CoV-2 (KP.2 Variant) Patient including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Casein Kinase 1 Substrate (CK1)
<p>Peptide RRKDLHDDEEDEAMSITA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C85H137N27O34SGlatiramer acetate
CAS:Controlled Product<p>Used to treat multiple sclerosis; anti-inflammatory</p>Formula:(C9H11NO3•C6H14N2O2•C5H9NO4•C3H7NO2)x•XC2H4O2Purity:Min. 95%Color and Shape:White PowderMolecular weight:623.65Myelin Proteolipid Protein (139-151)
<p>Peptide HSLGKWLGHPDKF is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C74H104N20O17Molecular weight:1,521.76 g/molCEA protein
<p>CEA protein is a native protein and antigen that plays a crucial role in various biological processes. It is involved in hepatocyte growth, lipase activity, and tyrosine metabolism. CEA proteins can be targeted by antibodies for research purposes in the life sciences field. Monoclonal antibodies such as trastuzumab can specifically bind to CEA proteins and are commonly used in cancer treatment. Additionally, CEA proteins have been found to interact with other molecules such as lipoprotein lipase and growth factors, indicating their involvement in multiple cellular pathways. Researchers often rely on CEA proteins as valuable tools for studying growth hormone receptors, endothelial growth, and other important biological processes.</p>Purity:>95% By Sds-Page And ElectrophoresisH-SIYSSRRF-OH
<p>H-SIYSSRRF-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SIYSSRRF-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SIYSSRRF-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SIYSSRRF-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-CKNTPDPDDLFSDI-OH
<p>Peptide Ac-CKNTPDPDDLFSDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>M3 / eCIRP (101-107) (Human, Mouse, Rat)
<p>Peptide H-RGFFRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:795.9 g/molCrosstide
<p>Please enquire for more information about Crosstide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Molecular weight:1,420.6 g/molThyroglobulin Antibody Positive Human Serum
<p>Please enquire for more information about Thyroglobulin Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Indacaterol maleate
CAS:Controlled Product<p>Long-acting β2-agonist; bronchodilator</p>Formula:C24H28N2O3·C4H4O4Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:508.56 g/molH-DLTEDHSSLLLHVK-OH
<p>H-DLTEDHSSLLLHVK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DLTEDHSSLLLHVK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DLTEDHSSLLLHVK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DLTEDHSSLLLHVK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-CRKPVLRKAFQHQPGKK-NH2
<p>Ac-CRKPVLRKAFQHQPGKK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CRKPVLRKAFQHQPGKK-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CRKPVLRKAFQHQPGKK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CRKPVLRKAFQHQPGKK-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%H-RRGWEALKY-OH
<p>H-RRGWEALKY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RRGWEALKY-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RRGWEALKY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RRGWEALKY-OH at the technical inquiry form on this page</p>Purity:Min. 95%HIV - 1 MN ENV - 143
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,696.1 g/molH-YELGVEITPPESIYPDFR-OH
<p>H-YELGVEITPPESIYPDFR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YELGVEITPPESIYPDFR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YELGVEITPPESIYPDFR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YELGVEITPPESIYPDFR-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-IGDQEFDSLPALLEFYK-OH
<p>H-IGDQEFDSLPALLEFYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IGDQEFDSLPALLEFYK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IGDQEFDSLPALLEFYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IGDQEFDSLPALLEFYK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Histone H3 (1-34)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C144H260N54O44Molecular weight:3,451.98 g/molEledoisin
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C54H85N13O15SMolecular weight:1,181.41 g/molTQS
CAS:<p>Please enquire for more information about TQS including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H20N2O2SPurity:Min. 95%Molecular weight:376.5 g/molAoa-KKSL-OH
<p>Peptide Aoa-KKSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNVQGDTK^-OH
<p>Peptide H-LNVQGDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LDHA antibody
<p>LDHA antibody was raised in mouse using recombinant human LDHA (1-332aa) purified from E.coli as the immunogen.</p>Eliglustat
CAS:<p>Eliglustat is an oral medication used as a substrate reduction therapy for Gaucher disease type 1, which is an inherited lysosomal storage disorder. This product is a small-molecule inhibitor derived via chemical synthesis. Its primary mode of action involves the selective inhibition of glucosylceramide synthase, an enzyme responsible for the first committed step in glycosphingolipid biosynthesis. By reducing the production of glucosylceramide, eliglustat decreases the substrate accumulation that contributes to the pathophysiology of Gaucher disease.</p>Formula:C23H36N2O4Purity:Min. 97 Area-%Color and Shape:White PowderMolecular weight:404.54 g/molTranylcypromine HCl
CAS:Controlled Product<p>Inhibitor of monoamine oxidase</p>Formula:C9H12ClNPurity:Min. 95%Color and Shape:PowderMolecular weight:169.65 g/molH-STRDPLSEITK^-OH
<p>Peptide H-STRDPLSEITK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-KPREEQFQSTYRVVSC-NH2
<p>Ac-KPREEQFQSTYRVVSC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-KPREEQFQSTYRVVSC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-KPREEQFQSTYRVVSC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-KPREEQFQSTYRVVSC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Ac-CS-NH2
<p>Peptide Ac-CS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-89/aa353 - 367
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,492.8 g/molH-LPPYLFT-OMe
<p>Peptide H-LPPYLFT-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CBFB antibody
<p>CBFB antibody was raised in mouse using recombinant Human Core-Binding Factor, Beta Subunit</p>Cetilistat - Bio-X ™
CAS:<p>Cetilistat is a drug that is used to treat obesity. This drug inhibits the enzyme pancreatic lipase and so it prevents triglycerides from being hydrolyzed into absorbable free fatty acids.</p>Formula:C25H39NO3Purity:Min. 95%Color and Shape:PowderMolecular weight:401.58 g/molSm protein
<p>The Sm protein is a versatile protein that plays various roles in the body. It has been implicated in amyloid plaque formation and acts as a growth factor for cells. The Sm protein is also involved in immune responses, as it can generate autoantibodies. This protein contains basic amino acids and undergoes glycosylation, which adds sugar molecules to its structure. Additionally, the Sm protein possesses an epidermal growth factor (EGF)-like domain, similar to the EGF found in human serum albumin protein. It has phosphatase activity and can act as a nuclear inhibitor. Overall, the Sm protein is a multifunctional molecule with diverse functions in different biological processes.</p>Purity:Min. 95%Streptococcus Group B antibody
<p>Streptococcus group B antibody was raised in rabbit using group B Streptococci as the immunogen.</p>Purity:Min. 95%Z-DNA antibody
<p>Z-DNA antibody was raised in sheep using brominated poly-(DG-DC)-left handed DNA (Z-DNA) complexed to methylated BSA as the immunogen.</p>Purity:Min. 95%Amifostine trihydrate
CAS:<p>Amifostine trihydrate is a cytoprotective agent, which is a synthetic organic compound used primarily in oncology. It is a phosphorylated aminothiol prodrug derived from chemical synthesis. Its mode of action involves dephosphorylation to its active metabolite, WR-1065, by alkaline phosphatase enzymes present in normal tissues. This active form then scavenges free radicals and enhances DNA repair mechanisms, providing selective protection to normal tissues during chemotherapy or radiation therapy.</p>Formula:C5H15N2O3PS·3H2OPurity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:268.27 g/molβ-Amyloid (4-10)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C39H52N12O12Molecular weight:880.92 g/molDiacerein - Bio-X ™
CAS:<p>Diacerein is a slow-onset anthraquinone IL-1 inhibitor that is used in the treatment of joint diseases such as osteoarthritis. This drug is also being studied for the treatment of insulin resistance and diabetes mellitus. Diacerein works to decrease inflammation and cartilage destruction by reducing the level of interleukin-1.</p>Formula:C19H12O8Purity:Min. 95%Color and Shape:PowderMolecular weight:368.29 g/molPyr-ALA-OH
<p>Please enquire for more information about Pyr-ALA-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C10H14N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:242.23 g/molH-SHYYRDQRRERSRSYERTGR-OH
<p>H-SHYYRDQRRERSRSYERTGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SHYYRDQRRERSRSYERTGR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SHYYRDQRRERSRSYERTGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SHYYRDQRRERSRSYERTGR-OH at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-L-Asp(OtBu)-(Dmb)β-Ala-OH
<p>Please enquire for more information about Fmoc-L-Asp(OtBu)-(Dmb)β-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H40N2O9Purity:Min. 95%Molecular weight:632.7 g/molNeuropeptide-Like Protein 12 (NLP-12) (33-39) (54-60) amide (C. elegans)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:937.05 g/mol3-Deazaneplanocin hydrochloride - Technical
CAS:<p>Inhibitor of S-adenosylhomocysteine hydrolase that disrupts histone methylation by EZH2. Anti-proliferative in some breast cancer and invasive prostate cancer cell lines. One of four key molecules required for inducing chemical reprogramming of somatic cells into induced pluripotent stem cells (iPSC).</p>Formula:C12H14N4O3·ClHPurity:Min. 70 Area-%Color and Shape:PowderMolecular weight:298.73 g/molCD68 antibody
<p>CD68 antibody was raised in mouse using a synthetic peptide conjugated to KLH as the immunogen</p>Ac-ISQAVHAAHAEINEAGR-NH2
<p>Peptide Ac-ISQAVHAAHAEINEAGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ML-109
CAS:<p>ML-109 is a synthetic chemical compound that acts as a feeding stimulant, commonly used in entomological research. It is developed through organic synthesis, allowing for precise manipulation of its molecular structure to optimize efficacy. The mode of action for ML-109 involves mimicking natural compounds that trigger feeding responses in insects, effectively activating chemoreceptors and neural pathways associated with food intake.</p>Formula:C31H29N3O5Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:523.58 g/molCRP antibody
<p>CRP antibody was raised in goat using Purified human CRP as the immunogen.<br>C-Reactive Protein (CRP) is an acute-phase inflammatory, pentameric plasma protein. Awarded its name after being first discovered reacting with the capsular (C)-polysaccharide of the Pneumococcus infection, CRP has since been found to activate the classical complement pathway of innate immunity. Dependent on the presence of calcium ions on its ligand-binding face, CRP specifically stimulates C1q when binding to phosphocholine and other polysaccharides located on microorganisms. Expression of CRP is increased (primarily in the hepatocytes) when inflammatory cytokines such as interleukin-6 are elevated during infection and some conditions such as rheumatoid arthritis and cardiovascular diseases.</p>gp100 (457-466)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C47H85N13O15Molecular weight:1,072.28 g/molAFP antibody
<p>AFP antibody was raised in mouse using purified AFP from cord Blood as the immunogen.</p>Biot-RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS-OH
<p>Peptide Biot-RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>AGN 220653
CAS:<p>AGN 220653 is a research tool that is an activator of the Ligand, Receptor and Cell Biology. It can be used to study protein interactions and pharmacology. This product is also a high purity ion channel inhibitor.</p>Formula:C36H42FN3O6SPurity:Min. 95%Molecular weight:663.8 g/molCMVpp65 - 69 (RNGFTVLCPKNMIIK)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,655.2 g/molHXB2 gag NO-38/aa149 - 163
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,740 g/molBisoprolol hemifumarate - Bio-X ™
CAS:Controlled Product<p>Bisoprolol is a β1- adrenergic antagonist agent that is used to treat hypertension and prevent myocardial infarction. As adrenergic neurotransmitters activate β1-receptors it causes an increase in blood pressure and heart rate. By reducing contractility and the need for oxygen through competitive inhibition of β1-adrenergic receptors, bisoprolol reduces the cardiac workload.</p>Formula:C18H31NO4C4H4O4Purity:Min. 95%Color and Shape:PowderMolecular weight:383.48 g/molAc-DHRREAHPKATAKHRC-NH2
<p>Ac-DHRREAHPKATAKHRC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-DHRREAHPKATAKHRC-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-DHRREAHPKATAKHRC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-DHRREAHPKATAKHRC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Methyltetrazine-GLFDIIKKIAESF-OH
<p>Peptide Methyltetrazine-GLFDIIKKIAESF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SARS-CoV-2 Positive Human Nasal Swab (Dry)
<p>SARS-CoV-2 Positive Human Nasal Swab (Dry) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-2 Positive Human Nasal Swab (Dry) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-VSTLPAITLK^-OH
<p>Peptide H-VSTLPAITLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ketoprofen - Bio-X ™
CAS:<p>Ketoprofen is a non-steroidal anti-inflammatory drug (NSAID) that has been used to treat pain and inflammation. Ketoprofen inhibits the production of inflammatory prostaglandins, which are released by platelets in response to injury or infection. The main mechanism of action is inhibition of cyclooxygenase enzymes COX 1 and COX 2 at the level of transcriptional activation. This results in decreased levels of prostaglandins that mediate pain, fever and inflammation.</p>Formula:C16H14O3Purity:Min. 95%Color and Shape:PowderMolecular weight:254.28 g/molH-QLLAPGNSAGAFLIR^-OH
<p>Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PKI 587
CAS:<p>PI3K/mTOR kinase inhibitor; anti-neoplastic</p>Formula:C32H41N9O4Purity:Min. 95%Color and Shape:White To Off-White SolidMolecular weight:615.73 g/molH-YLGYLEQLLR^-OH
<p>Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNCLWLRPQPIFLWKLR-OH
<p>H-LNCLWLRPQPIFLWKLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LNCLWLRPQPIFLWKLR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LNCLWLRPQPIFLWKLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LNCLWLRPQPIFLWKLR-OH at the technical inquiry form on this page</p>Purity:Min. 95%SIVmac239 - 3
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,740 g/molH-VNFYAWK^-OH
<p>Peptide H-VNFYAWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-GAGSLQPLALEGSLQKRG-OH
<p>Peptide Fluor-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Oseltamivir phosphate - Bio-X ™
CAS:Controlled Product<p>Oseltamivir is a neuraminidase inhibitor that is used to treat influenza. It is an antiviral drug that is an inhibitor of influenza virus neuraminidase enzymes. This drug reduces viral infectivity and shedding.</p>Formula:C16H31N2O8PPurity:Min. 95%Color and Shape:PowderMolecular weight:410.4 g/molIgM, Highly Purified
<p>IgM, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IgM, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-LNIPTDVLK^-OH
<p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTAGVSPK^-OH
<p>Peptide H-YTAGVSPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPEAPPSVR^-OH
<p>Peptide H-YPEAPPSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSLQKRGIV^E-OH
<p>Peptide H-GSLQKRGIV^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ala-Asp-Ser-Asp-Pro-Arg
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C25H41N9O12Molecular weight:659.65 g/molH-RVLEANDGSGMLDEDEEDLQ-OH
<p>H-RVLEANDGSGMLDEDEEDLQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RVLEANDGSGMLDEDEEDLQ-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RVLEANDGSGMLDEDEEDLQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RVLEANDGSGMLDEDEEDLQ-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-SSDTEENVK^-OH
<p>Peptide H-SSDTEENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MRL^LPLLAL-OH
<p>Peptide H-MRL^LPLLAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NButGT
CAS:<p>NButGT (N-butyryl-glucosamine-1,5-lactone O-(phenylcarbamoyl)oxime) is a selective inhibitor of O-GlcNAcase (OGA), the enzyme responsible for removing O-linked N-acetylglucosamine (O-GlcNAc) modifications from proteins. It effectively increases O-GlcNAc levels in cells and tissues without altering hexosamine biosynthetic pathway enzyme expression. It has also been shown that NButGT rapidly increases O-GlcNAcylation of mitochondrial proteins involved in oxidative phosphorylation and metabolism. While effective, NButGT served as a precursor to more potent OGA inhibitors like Thiamet-G. These findings highlight NButGT's importance as a tool for studying O-GlcNAcylation in various biological contexts, particularly in cardiac and neurological research. For example, in recent cardiac studies, NButGT pretreatment has demonstrated an improvement in cardiac output and mitochondrial respiration when combined with epinephrine.</p>Formula:C10H17NO4SPurity:Min. 95%Color and Shape:PowderMolecular weight:247.31 g/molAc-GEGQQHHLGGAKQAGDV-OH
<p>Peptide Ac-GEGQQHHLGGAKQAGDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-REEE-NH2
<p>Peptide Ac-REEE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-YGGFLRRIRPKLKWDNQ-OH
<p>Peptide LCBiot-YGGFLRRIRPKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-R^TPDYFL-OH
<p>Peptide H-R^TPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Meldonium dihydrate - Bio-X ™
CAS:Controlled Product<p>Meldonium is an experimental drug that was developed to treat cardiovascular conditions. This drug helps to improve blood flow, increase oxygen uptake and improve energy metabolism.</p>Formula:C6H14N2O2•(H2O)2Purity:Min. 95%Color and Shape:PowderMolecular weight:182.22 g/molNeuregulin 4 (Nrg4) / pro-Neuregulin 4 (1-61) (Human)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:6,656.63 g/molAc-WEDWVGWI-NH2
<p>Peptide Ac-WEDWVGWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIPNPDFFEDLEPFR^-OH
<p>Peptide H-KIPNPDFFEDLEPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GELNEHLGLLGPYIR^-OH
<p>Peptide H-GELNEHLGLLGPYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VINDFVEK^-OH
<p>Peptide H-VINDFVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFER^-OH
<p>Peptide H-LLFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIPGGIYDADLNDEWVQR^-OH
<p>Peptide H-IIPGGIYDADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLNQTDETL^-OH
<p>Peptide H-FLNQTDETL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>norleucyl-piperidine
<p>Peptide norleucyl-piperidine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HPV 33 E6 64-72 (HLA-A*03:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>SARS-CoV-2 Antigen Peptide NCAP (TWLTYTGAIKLDDKDPNF)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C97H144N22O30Molecular weight:2,098.43 g/molH-YTDV^SNMSHLA-OH
<p>Peptide H-YTDV^SNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IDEALER^-OH
<p>Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CRAELEKHGYKMETS
<p>Ac-CRAELEKHGYKMETS is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-OH
<p>H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C190H288N54O57Molecular weight:4,240.7 g/molAoa-KRRGSTCVLA-NH2
<p>Peptide Aoa-KRRGSTCVLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLSLEEIQK^-OH
<p>Peptide H-DLSLEEIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIAFSR^-OH
<p>Peptide H-SIAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>9-(4-Chlorobenzyl)-6- methoxy-1-methyl-4,9-dihydro-3H-pyrido[3,4-b]indol
CAS:<p>novel tricyclic indole; promising new treatment for a variety of diseases</p>Formula:C20H19ClN2OPurity:Min. 99 Area-%Color and Shape:Slightly Brown PowderMolecular weight:338.83 g/molH-EGYLQIGANTQAAQK^-OH
<p>Peptide H-EGYLQIGANTQAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-MTATHAVDEAVS-NH2
<p>Peptide Ac-MTATHAVDEAVS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-IEELQSNHGVDDEDSDNDG-NH2
<p>Peptide Ac-IEELQSNHGVDDEDSDNDG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cy5-TFSDLWKLL-OH
<p>Peptide Cy5-TFSDLWKLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQHNTKYSVVIR-NH2
<p>Peptide H-VQHNTKYSVVIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSVFPLAPSSR^-OH
<p>Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Myr-GSNK^SK^PK-NH2
<p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDLER^-OH
<p>Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFVPPFQQSPR^-OH
<p>Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QFYDQALQQAVVDDDANNAK^-OH
<p>Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH
<p>H-GRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGRGR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C200H377N125O51Molecular weight:5,349 g/molH-NFLINETAR^-OH
<p>Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Anti-T2A antibody
<p>Crude antiserum was purified by affinity chromatography from a glycine elute using peptide specific antigen</p>Color and Shape:Clear LiquidH-KL^VVVGACGV^-OH
<p>H-KLVVVGACGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C42H77N11O11S1Molecular weight:944.2 g/molH-YLWEWASVR^-OH
<p>Peptide H-YLWEWASVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HIFDHVIGPEGVLAGK^-OH
<p>Peptide H-HIFDHVIGPEGVLAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYNPLWLRI-OH
<p>H-SYNPLWLRI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SYNPLWLRI-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SYNPLWLRI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SYNPLWLRI-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-LLDEVTYLEASK^-OH
<p>Peptide H-LLDEVTYLEASK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQQCVIMAENR^-OH
<p>Peptide H-EQQCVIMAENR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WYQNMIR^-OH
<p>Peptide H-WYQNMIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTFASLSELHCDK^-OH
<p>Peptide H-GTFASLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PB-PKKKRKV
<p>Peptide PB-PKKKRKV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQSIQPFISR^-OH
<p>Peptide H-GQSIQPFISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
<p>H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>pE-LYENKPRRPYIL
<p>pE-LYENKPRRPYIL is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C73H116N20O18Molecular weight:1,561.84 g/molH-LSVPTSEWQR^-OH
<p>Peptide H-LSVPTSEWQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDFGLAR^-OH
<p>Peptide H-ILDFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>4'-Methylchrysoeriol
CAS:<p>4'-Methylchrysoeriol is a ligand that binds to the allosteric site of the nicotinic acetylcholine receptor (nAChR) and activates it. It has been shown to be a potent inhibitor of the nAChR. 4'-Methylchrysoeriol has been used as a research tool to study the effects of channel activation on cell biology and ion channels, as well as for investigating protein interactions.</p>Formula:C17H14O6Purity:Min. 95%Color and Shape:PowderMolecular weight:314.29 g/molAc-RRRRRRRRRRRR-OH
<p>Peptide Ac-RRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGYPITDDLDIYTR^-OH
<p>Peptide H-LGYPITDDLDIYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEETVQAK^-OH
<p>Peptide H-LEETVQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFSWASVTSK^-OH
<p>Peptide H-TFSWASVTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Follicle Stimulating Hormone (FSH), Recombinant
<p>Please enquire for more information about Follicle Stimulating Hormone (FSH), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:≥95% By Sds-Page.H-AVEIGSFLLGR^-OH
<p>Peptide H-AVEIGSFLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAALGCLVKDYFPEPVTV-OH
<p>H-TAALGCLVKDYFPEPVTV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TAALGCLVKDYFPEPVTV-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TAALGCLVKDYFPEPVTV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TAALGCLVKDYFPEPVTV-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-DPK^PIPGNW-OH
<p>Peptide H-DPK^PIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFDSFGDLSSASAIMGNAK^-OH
<p>Peptide H-YFDSFGDLSSASAIMGNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5TAMRA-LKRYKRRL-OH
<p>Peptide 5TAMRA-LKRYKRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RR^-OH
<p>Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLRGRAYGL^-OH
<p>Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-95/aa377 - 391
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,906.3 g/molgp100 (86-95)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>CEA (605-613)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C43H69N11O14Molecular weight:964.09 g/molRibosomal protein L3 peptide (202-222) amide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C114H182N42O25SMolecular weight:2,573 g/molH-VYIHP^F-OH
<p>Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TENNDHINLK^-OH
<p>Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLRLGWEALKYLWNL-OH
<p>H-GLRLGWEALKYLWNL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GLRLGWEALKYLWNL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GLRLGWEALKYLWNL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GLRLGWEALKYLWNL-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-APASEEEFQFLR^-OH
<p>Peptide H-APASEEEFQFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTYADFIASGRTGRRNSIHD-NH2
<p>Peptide H-TTYADFIASGRTGRRNSIHD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YMVIQGEPGAVIR^-OH
<p>Peptide H-YMVIQGEPGAVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGKGLSATVTGGQK^GRGSR-OH
<p>Peptide H-CGKGLSATVTGGQK^GRGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAVVR^-OH
<p>Peptide H-VAVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEIFYR^-OH
<p>Peptide H-VEIFYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVATVKEAGRSIHEIPR-OH
<p>H-LVATVKEAGRSIHEIPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LVATVKEAGRSIHEIPR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LVATVKEAGRSIHEIPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LVATVKEAGRSIHEIPR-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-NLWAAQRYGRELRRMSDEFVDSFKK-NH2
<p>Peptide Ac-NLWAAQRYGRELRRMSDEFVDSFKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PIIHFGSDYEDR^-OH
<p>Peptide H-PIIHFGSDYEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 56
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,622.9 g/molH-L^SQLQTYMI^-OH
<p>Peptide H-L^SQLQTYMI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GMNYLEDR^-OH
<p>Peptide H-GMNYLEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
