Biochemicals and Reagents

<p>Peptide H-FYVQALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NAVPITPTLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ASMA/Actin/F-Actin Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ASMA/Actin/F-Actin Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>RF Ig Total Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about RF Ig Total Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>CYP2C19 antibody was raised using the middle region of CYP2C19 corresponding to a region with amino acids QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD</p>

<p>Mycoplasma Pneumoniae IgG Negative Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Mycoplasma Pneumoniae IgG Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Toxocara Canis IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Toxocara Canis IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>HAMA Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HAMA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti-human IgM is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Goat anti-human IgM including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>ANA IgG Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ANA IgG Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Tetanus Toxoid Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Tetanus Toxoid Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Boc-His(Tos)-OH is an activating reagent for solid-phase peptide synthesis. It can be used as a building block for the synthesis of peptide chains on a solid support. Boc-His(Tos)-OH is typically used in conjunction with other reagents, such as Fmoc-amino acids and DCC, to synthesize amino acid sequences on the surface of the resin. This reagent is often used in high-throughput peptide synthesis protocols.</p>

<p>Neuromedin U8 (Porcine) is a peptide that binds to the receptor for Neuromedins. It has been shown to inhibit cell proliferation and induce apoptosis in some cancer cells. Neuromedin U8 has also been shown to have a protective effect on the bowel by inhibiting inflammatory bowel disease. The peptide is also known to be active on other physiological functions and metabolic disorders, such as amide metabolism and hypertrophy, which are due to its conformational properties.</p>

<p>Toxin; induces pulmonary hypertension</p>

<p>Peptide H-IPLNDLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Troponin I antibody was raised in goat using purified human cardiac troponin I as the immunogen.</p>

<p>CA-074 is a research tool that can be used to study protein interactions. CA-074 is a small, synthetic peptide and a potent inhibitor of the ion channel TRPC1. It has been shown to inhibit the calcium currents in HEK293 cells expressing TRPC1 channels. CA-074 inhibits the kinase activity of PLCγ2, which leads to reduced phosphoinositide levels and a decrease in cell proliferation. CA-074 also inhibits PKCδ and PKCε, which are members of the protein kinase C family.<br>The inhibition of these enzymes by CA-074 causes an increase in the intracellular concentration of diacylglycerol (DAG) and inositol triphosphate (IP3). These two molecules are involved in G protein signaling pathways that regulate cell proliferation, differentiation, and survival.</p>

<p>Jo-1 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Jo-1 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The Keratin 8 antibody is a highly specific and sensitive tool used in life sciences research. This antibody specifically targets and detects autoantibodies against skeletal myosin, cardiomyocyte antigens, and glucagon. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.</p>

<p>Chlamydia Trachomatis IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Chlamydia Trachomatis IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Cytosolic Liver Antigen, Type 1 (Lc-1) Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Cytosolic Liver Antigen, Type 1 (Lc-1) Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Fluvastatin is a statin that lowers blood cholesterol and triglycerides by inhibiting HMG-CoA reductase, an enzyme that plays a critical role in the synthesis of cholesterol. Fluvastatin has also been shown to reduce the incidence of myocardial infarction, and to reduce atherosclerotic lesions in animal models, reducing the incidence of cardiovascular disease. Fluvastatin also has been shown to inhibit the activation of toll-like receptor 4 (TLR4) by lipopolysaccharide (LPS), which may be related to its anti-inflammatory effects. Furthermore, through lowering blood cholesterol, Fluvastatin also inhibits tubulointerstitial injury and prevents renal damage caused by high concentrations of the lipid.</p>

<p>Cardiolipin/Beta-2-glycoprotein-1 IgA/IgG/IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Cardiolipin/Beta-2-glycoprotein-1 IgA/IgG/IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>TBE IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about TBE IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>IGF1 antibody was raised in mouse using human IGF-I as the immunogen.</p>

<p>Influenza A/B, SARS-CoV-2 and R&amp;V Negative Nasopharyngeal Swab (Copan UTM) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza A/B, SARS-CoV-2 and R&amp;V Negative Nasopharyngeal Swab (Copan UTM) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>ASO Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ASO Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Presented as a purified antigen in proprietary buffer, pH 10. This recombinant SARs-CoV-2 Spike S1-S2 chimeric protein has been expressed in insect cells and purified by chromatography. It is important to note that repeated freezing and thawing should be avoided and it is suitable for ELISA assays and similar solid phase formats.<br>The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), causes the Coronavirus Disease-2019 (COVID-19) and has dominated the world’s scientific attention since it was first reported in December 2019. Symptoms, which may include shortness of breath and fever, result from SARs-CoV-2 binding to the host cell receptors: angiotensin-converting enzyme 2 (ACE2) present in the arterial smooth muscle cells and endothelial cells and additionally venous endothelial cells in organs. This interaction is carried out by the SARs-CoV-2’s spike protein. Of the two subunits that this spike protein is composed of, S1 binds the ACE2 receptors through its receptor binding domain while S2 initiates membrane fusion between the virus and host through forming a hairpin structure. While the spike protein subunits can be collectively used as the immunogen in vaccine development, the receptor binding domain in the S1 subunit is of particular interest for the development of neutralizing antibodies. Interestingly a proline substitution within the S2 domain enhances the immunogenicity of this spike protein.</p>

<p>Haemoglobin A1c Solution (&lt;3.5% HbA1c) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Haemoglobin A1c Solution (&lt;3.5% HbA1c) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Cardiolipin IgG/Beta-2-Glycoprotein-1 IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Cardiolipin IgG/Beta-2-Glycoprotein-1 IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Collagenosis Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Collagenosis Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide Boc-VLK-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Strep A Positive Human Swab (Liquid Amies) is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Strep A Positive Human Swab (Liquid Amies) including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Ghrelin is a peptide hormone that has various effects on the body, including stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and asserts its functional affects through acting as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). Its wider functions such as glucose homeostasis, energy homeostasis, cardio-protective effects, its role in bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This product is available in the trifluoroacetate salt form and as a 0.1mg vial.</p>

<p>ASCA IgG/IgA/IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about ASCA IgG/IgA/IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Porcine Intrinsic Factor</p>

<p>H-PFTSVNHKVLDSIYSSRRFH-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PFTSVNHKVLDSIYSSRRFH-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PFTSVNHKVLDSIYSSRRFH-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PFTSVNHKVLDSIYSSRRFH-OH at the technical inquiry form on this page</p>

<p>tTG/DGP Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about tTG/DGP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Coronavirus NL63 IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Coronavirus NL63 IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>LKM-1 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about LKM-1 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Nucleosome/Histone/Chromatin Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Nucleosome/Histone/Chromatin Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>EBV VCA IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about EBV VCA IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>HBs Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HBs Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-SGAQASSTPLSPTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Gp210/PML/Sp100 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Gp210/PML/Sp100 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>beta Actin antibody was raised in mouse using beta-Actin N-terminal peptide-KLH conjugates as the immunogen.</p>

<p>Leptospira Interrogans LPS Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Leptospira Interrogans LPS Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Adenovirus IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Adenovirus IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Mumps IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Mumps IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>PML Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about PML Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

Sterile Filtered Calf Serum

<p>Normal Paediatric Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Normal Paediatric Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>DFS-70 Antibody Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about DFS-70 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Treponema pallidum IgG Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Treponema pallidum IgG Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Rubella IgG Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Rubella IgG Positive, EBV VCA &amp; EBNA IgG Negative EDTA Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Sarafotoxin S6c, sourced from the venom of the Atractaspis engaddensis snake family, is one of four (S6a-d) isopeptides of the Sarafotoxins. This product is a synthetically produced toxin, containing disulfide bonds between Cys1-Cys15 and Cys3-Cys11.<br>Due to their structural and functional homology to the endothelin peptides, Sarafotoxins can enhance vasoconstriction through stimulating the class A G-protein-coupled, endothelin ETA and ETB receptors. This in turn leads to left ventricular dysfunction and bronchoconstriction. Compared to the sarafotoxin isopeptide S6b, S6c is less toxic with a 100 to 10,000-fold reduced affinity for the ETA receptor, therefore acts as a selective agonist to the ETB receptor. One study demonstrated that when sarafotoxin 6c was used to activate ETB receptors in rats there was an increase in arterial pressure, known as S6c-induced hypertension.<br>As the upregulation of Endothelin-1 (ET-1) is related to circulatory-system diseases, the interaction between ET-1 and its receptors is highly important for development of endothelin receptor antagonist treatments. Sarafotoxin S6c can be used as a pharmacological reagent to study these interactions.</p>

<p>Roflumilast is a selective phosphodiesterase-4 inhibitor that is used for the treatment of exacerbations in patients with chronic obstructive pulmonary disease (COPD). It is also used to treat plaque psoriasis. This drug has anti-inflammatory and immunomodulatory effects as it aids in increasing levels of cAMP.</p>

<p>Ac-CGGSAQSQRAPDRVLS-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CGGSAQSQRAPDRVLS-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CGGSAQSQRAPDRVLS-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CGGSAQSQRAPDRVLS-NH2 at the technical inquiry form on this page</p>

Branaplam is a small-molecule drug that binds to the messenger RNA of the enzyme protein kinase C (PKC) and inhibits its activity. It has been shown to be effective in treating PKC-dependent diseases, such as cancer and autoimmune disorders. Branaplam is also used for the diagnosis of PKC-dependent diseases by detecting PKC mRNA levels in cells or tissues. This compound can be used for the treatment of human patients with PKC-dependent diseases, including cancer, rheumatoid arthritis, multiple sclerosis, and asthma.

<p>Goat polyclonal Human CRP antibody</p>

<p>Elastase antibody was raised in mouse using purified human neutrophil elastase as the immunogen.</p>

FMOC-Arg(Pbf)-Rink-Amide MBHA Resin is a research tool used in cell biology and pharmacology. It is an activator of ion channels and a ligand for receptors. This resin is used to study protein interactions, antibody specificity, and peptide binding properties. The resin can be used as an inhibitor of the phosphorylation of proteins in cells. FMOC-Arg(Pbf)-Rink-Amide MBHA Resin has been shown to be useful in pharmacology for the treatment of various diseases such as diabetes and hypertension.

Peptide LCBiot-KYEQYIKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Fmoc-Ser(tBu)-OH is a synthetic peptide that is used in the synthesis of peptides and proteins. It is synthesized by using a stepwise procedure, which involves the use of morpholine as an organic base to deprotonate the carboxylic acid group and then reacting it with trifluoroacetic acid (TFA) to form the corresponding chloroformate ester. The amide bond is formed by reaction with ammonia or an amine. Finally, it can be reacted with hydrochloric acid to form the corresponding hydrochloride salt, which is insoluble in water. Impurities such as thionyl chloride and chloroformate can be removed by washing with methylene chloride or chloroform, respectively. Fmoc-Ser(tBu)-OH has been shown to be selective for the formation of hydrophobic bonds between amino acids and is not reactive toward other side chains on the protein.</p>

<p>H-Tyr-Ala-Pro-Gly-Lys-Phe-NH2 is a synthetic peptide that can activate the PAR4 receptor. The PAR4 receptor is activated by proteolytic cleavage, which occurs when PAR4 interacts with the enzyme thrombin. Activation of the PAR4 receptor leads to vasodilation and increased blood flow. H-Tyr-Ala-Pro-Gly-Lys-Phe NH2 has shown potential for use in cardiovascular diseases such as hypertension, which is characterized by elevated blood pressure.</p>

<p>Peptide H-GV^YDGEEHSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.</p>

<p>Ac-PVSLLEKAAPQWC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-PVSLLEKAAPQWC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-PVSLLEKAAPQWC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-PVSLLEKAAPQWC-NH2 at the technical inquiry form on this page</p>

<p>CA-074 Me is a small molecule that binds to the receptor site of the ion channel. This binding triggers a conformational change in the ion channel, which leads to an influx of ions and an increase in membrane potential. CA-074 Me has also been shown to bind to peptide receptors and activate them, leading to similar effects on cell membranes as with ion channels. CA-074 Me is used for research purposes as it can be used as a tool for studying protein interactions and ligand-receptor binding. It is also often used as an antibody capture reagent. CA-074 Me is a research chemical that was synthesized by Hetero Drugs Limited (India) and has CAS No. 147859-80-1.END&gt;</p>

<p>Luteinizing Hormone (LH) Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Luteinizing Hormone (LH) Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

Peptide LCBiot-GRPRTTSFAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).</p>

<p>Peptide H-LTIGEGQQHHLGGA^K^QA^GDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-IKEKIEELQ-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IKEKIEELQ-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IKEKIEELQ-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IKEKIEELQ-OH at the technical inquiry form on this page</p>

<p>Peptide H-LLETECPQYIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KETAAAKFERQHMDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide BrAc-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Desmethoxy apixaban including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ala-OH is a peptide that is used in the treatment of skin cancer. It has been shown to have antitumor properties, as well as antiviral and antifungal effects. Boc-Ala-OH has been shown to inhibit proteolytic enzymes, such as collagenase and elastase, which are involved in the development of inflammatory diseases. This peptide also binds to human serum albumin with high affinity, which may be an important factor in its therapeutic effect. Boc-Ala-OH inhibits the enzyme activities of neutrophils by binding to their membranes and changing the permeability of these cells, which causes them to release cytotoxic granule contents. This peptide also inhibits squamous cell carcinoma and other types of cancerous cells.</p>

<p>Peptide H-WRWYRGGRYWRW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VFDEFKPLVEEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HSV1 + HSV2 gB antibody was raised in mouse using herpes simplex virus glycoprotein B (gB) as the immunogen.</p>

<p>H-FQHSLAITNNFANGDK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-FQHSLAITNNFANGDK-OH is provided at greater that Flashpure (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-FQHSLAITNNFANGDK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-FQHSLAITNNFANGDK-OH at the technical inquiry form on this page</p>

<p>Peptide H-APLILSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Tyrosine kinase inhibitor; antineoplastic activity; pro-apoptotic</p>

<p>Ac-DPYRPVRLPMQKLPTRC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-DPYRPVRLPMQKLPTRC-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-DPYRPVRLPMQKLPTRC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-DPYRPVRLPMQKLPTRC-NH2 at the technical inquiry form on this page</p>

<p>H-KRAFSLKHI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KRAFSLKHI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KRAFSLKHI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KRAFSLKHI-OH at the technical inquiry form on this page</p>

<p>Fluorescent Brightener 191 is a monomer that can be used in the textile industry to increase brightness and fluorescence of textiles. It is water soluble, non-toxic, and stable. The impurities of this product are monitored by testing for chloride ion content. Fluorescent Brightener 191 is also used for effervescent and osmosis control in water treatment plants, as well as clarification of wastewater effluent. Its fluorescence properties make it an ideal choice for monitoring the presence of substances, such as chloride ions, in solution by measuring the intensity of light emitted from a sample. Fluorescent Brightener 191 is also known to have a high solubility in organic solvents such as chloroform or acetone, which makes it suitable for labeling purposes.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its exceptional bactericidal activity against tuberculosis infections. By binding to DNA-dependent RNA polymerase, it effectively inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques such as patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.</p>

<p>Peptide H-G^^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Lys(Glucitol, Boc)-OH is a synthetic peptide that acts as an inhibitor of the ion channel TRPC3. It binds to the ligand-binding site of TRPC3, preventing activation by its natural agonist, lysophosphatidic acid (LPA). Fmoc-Lys(Glucitol, Boc)-OH can also be used as a research tool in pharmacology and cell biology. It has been shown to inhibit the growth of cancer cells. This product is available at a purity of &gt; 98%.</p>

<p>The HSV2 protein is a chimeric protein that has been extensively studied in the field of Life Sciences. It is commonly used for research purposes, particularly in the development of antibodies and monoclonal antibodies. The HSV2 protein is derived from human hepatocytes and is often conjugated with bovine γ-globulin or streptavidin for biotinylation or hybridization experiments. This protein can be used as a native protein or antigen to study various biological processes, such as natriuretic activity or the interaction with elastase protein. Its versatility and reliability make it an essential tool for scientists working in the field of Proteins and Antigens.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-KAPAGQETL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KAPAGQETL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KAPAGQETL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KAPAGQETL-OH at the technical inquiry form on this page</p>

<p>The SARS-CoV-2 Spike glycoprotein trimeric ectodomain is an inhibitor of ion channels. It can be used to study the biological effects of this protein on ion channel function. The SARS-CoV-2 Spike glycoprotein trimeric ectodomain is a recombinant protein that has been expressed in CHO cells and purified with a biotin tag. It is suitable for use as a research tool or as an antibody to study the function of ion channels.</p>

<p>Suc-Phe-Ala-Ala-Phe-pNA is an amino acid that is a substrate for the serine protease myroilysin. It is used in biochemical research to investigate the physiological function of myroilysin. Suc-Phe-Ala-Ala-Phe-pNA has been shown to be an irreversible inhibitor of myroilysin and inhibits enzyme catalysis.</p>

<p>Camostat mesilate is a prodrug that is metabolized to the active form, pemastatin. It is used for the treatment of bowel disease and squamous cell carcinoma. Camostat mesilate inhibits the TNF-α receptor by binding to its response element in vitro and in vivo. The biological properties of camostat mesilate are due to its ability to inhibit TNF-α production by binding to the TNF-α receptor, thereby preventing activation of transcription factors such as nuclear factor kappa B (NFκB). In vitro assays have shown that camostat mesilate induces apoptosis in human carcinoma cell lines through inhibition of growth factor-β1. This drug has also been shown to be effective in treating viral infections, including HIV and herpes zoster.</p>

<p>H-CALYEQEIR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CALYEQEIR-OH is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CALYEQEIR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CALYEQEIR-OH at the technical inquiry form on this page</p>

<p>Ac-SGQQQGLPRAAGGSVPC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SGQQQGLPRAAGGSVPC-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SGQQQGLPRAAGGSVPC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SGQQQGLPRAAGGSVPC-NH2 at the technical inquiry form on this page</p>

Ac-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt is a peptide that has been shown to have anti-cancer, enzyme inhibitory, and anti-inflammatory activities. The peptide is derived from the proteolytic cleavage of human collagenase. It inhibits both matrix metalloproteinases (MMPs) and stromelysin in vitro. Acetyl Proleu Gly Gly Leu Gly OEt has also been shown to inhibit cancer cells in culture by inhibiting RNA synthesis and protein synthesis.

<p>H-ENEMDENLEQVSGIIGNLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ENEMDENLEQVSGIIGNLR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ENEMDENLEQVSGIIGNLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ENEMDENLEQVSGIIGNLR-OH at the technical inquiry form on this page</p>

<p>Echistatin is a natural product isolated from the venom of the snake Echis carinatus. It is an inhibitor of protein synthesis that binds to the integrin receptor and blocks the binding of extracellular matrix proteins, leading to cell death. Echistatin has been shown to inhibit the proliferation of human osteosarcoma cells in vitro and induce neuronal death in vivo. In addition, it has been shown to be effective against human breast cancer cells that express high levels of integrins. The disulfide bond in echistatin may represent a potential anticancer agent due to its ability to form covalent bonds with other molecules such as DNA, RNA, or proteins.</p>

<p>This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.<br>Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.</p>

<p>H-VSFASFYSLWSVDHGE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VSFASFYSLWSVDHGE-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VSFASFYSLWSVDHGE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VSFASFYSLWSVDHGE-OH at the technical inquiry form on this page</p>

<p>Amyloid Beta-Protein (40-1) is a peptide that is found in the brain, and is thought to be involved in Alzheimer’s disease. Amyloid Beta-Protein (40-1) has been shown to inhibit protein interactions and activator functions, as well as act as a ligand for receptors. This protein can be used as a research tool for studying ion channels and antibodies. It also has high purity and can be used for life science experiments.</p>

<p>Peptide H-LGEYGFQNAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QTALVELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MASMTGGQQMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>D-Dimer antibody was raised in mouse using homogenized fibrin clot D-dimer or high molecular weight fibrin degradation products as the immunogen.</p>

<p>Peptide LCBiot-KQPADGNPDPNANPNVDPN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Collagen type II antibody was raised in rabbit using collagen type II from human knee cartilage and bovine nasal cartilage as the immunogen.</p>

<p>Peptide H-IQEVAGSLIFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Caffeoylputrescine is an analog of putrescine, a polyamine that is naturally found in urine. It has been shown to have potent anticancer properties by inducing apoptosis in cancer cells. Caffeoylputrescine inhibits the activity of kinases, which are enzymes that play a key role in cell growth and division. This inhibition leads to decreased tumor growth and increased cancer cell death. Additionally, caffeoylputrescine has been shown to enhance the activity of nifedipine, a calcium channel blocker commonly used for hypertension treatment. This compound also acts as a protein kinase inhibitor and may be useful in the development of new anticancer drugs for humans.</p>

<p>Peptide H-GIINTLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VLFGLGFAI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLFGLGFAI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLFGLGFAI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLFGLGFAI-OH at the technical inquiry form on this page</p>

Peptide Ac-CAQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ALPNNTSSSPQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VLTLDGMNPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLTLDGMNPR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLTLDGMNPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLTLDGMNPR-OH at the technical inquiry form on this page</p>

<p>Lys-Arg-OH acetate salt (LRA) is a protein transport peptide that is found in the neurosecretory system and has been used as a growth factor for the production of human insulin. LRA stimulates the release of pepsinogen, which breaks down food proteins into polypeptides and amino acids. It also has proteolytic activity, which helps break down proteins into peptides. LRA shares structural similarities with other peptide hormones such as vasopressin and oxytocin, but it differs by having an amide instead of an ester linkage between the lysine and arginine residues.</p>

<p>Inhibitor of CSF1R receptor</p>

<p>Peptide Ac-WLA-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VTLVVGASQDIIPQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VGYVSGWGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-RRPHFP^QFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NPQLCYQDTILWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Linagliptin is a dipeptidyl peptidase-4 inhibitor drug that is used to manage hyperglycaemia in patients with type 2 diabetes. This drug works by inhibiting the enzyme dipeptidyl peptidase-4 and allows for the breakdown of GLP-1 and glucose dependent insulinotropic polypeptide. As a result of this, breakdown of glycogen is reduced and release of insulin is increased.<br>Linagliptin is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&amp;D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.</p>

<p>Myosin light chain 1 antibody was raised in mouse using myosin light chain-1 as the immunogen.</p>

<p>A potent inhibitor of ubiquitin activating enzyme E1. Lowers ubiquitin conjugates in cells, thereby disrupting cell signalling, cell cycle progression and repair of DNA damage. Anti-tumor effects have been demonstrated in vitro and in vivo. TAK 243 has been used to study the biology of ubiquitins and its potential as anti-cancer therapy.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Myoglobin antibody was raised in goat using highly purified human cardiac myoglobin as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-GVLLPQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GVLLPQK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GVLLPQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GVLLPQK-OH at the technical inquiry form on this page</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide Palmitic Acid-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-YVYIAELL^AHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>A serotonin reuptake inhibitor with anticholinergic activity and mild inhibitory activity on noradrenaline reuptake. Paroxetine has been used for the treatment of depression, anxiety disorders, post-traumatic stress disorder, premenstrual dysphoric disorder and obsessive-compulsive disorder.  Also inhibits nitric oxide synthase and cytochrome isoenzyme P450 2D6.</p>

<p>Peptide H-ILPTLEAVAALGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Curcumin-glutaric acid conjugate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>COX1 inhibitor; blocker of Ca2+-activated non-selective cation channels</p>

<p>H-PSPSSRPPSRYQSGPNSLPP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PSPSSRPPSRYQSGPNSLPP-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PSPSSRPPSRYQSGPNSLPP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PSPSSRPPSRYQSGPNSLPP-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Voltage-dependent K+ channel opener; insulinotropic sulfonylurea receptor ligand</p>

<p>RSV IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about RSV IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Normal Goat Serum is a Biospecimen for use in pharmaceutical and diagnostic applications. Please enquire for more information about Normal Goat Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Goat anti Human IgG Fc antibody</p>

<p>17-AAG is the first clinically tested hsp90 inhibitor that exhibits antitumor activity. Its antitumor effects are documented in vivo for various animal models, including erbB2-dependent breast cancer, prostate cancer models, and melanoma.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>MUT antibody was raised in Rabbit using Human MUT as the immunogen</p>

Peptide H-IRKGQRDLYSGLNQR^RI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.