Biochemicals and Reagents

<p>Hydromorphone 3 Conjugate for use in immunoassays</p>

<p>FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS</p>

<p>Rabbit polyclonal SDHA antibody (HRP)</p>

<p>Deoxyribonuclease I antibody was raised in rabbit using bovine pancreatic deoxyribonuclease I as the immunogen.</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI</p>

<p>GALNTL2 antibody was raised in Rabbit using Human GALNTL2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP8B1 antibody, catalog no. 70R-9994</p>

<p>DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT</p>

<p>Mouse/Rabbit antigen staining reagent for use in IHC</p>

<p>Purified recombinant NEK7 protein</p>

<p>Purified Polyclonal ELMO1 antibody</p>

<p>The Cortactin antibody is a powerful tool for researchers studying various cellular processes. It specifically targets Cortactin, a protein that plays a crucial role in cell growth and migration. This antibody can be used to investigate the effects of growth factors and tumor necrosis factor-alpha (TNF-α) on Cortactin localization and activity.</p>

<p>GIMAP4 antibody was raised in Rabbit using Human GIMAP4 as the immunogen</p>

<p>The SOCS3 antibody is a highly specialized monoclonal antibody that targets the suppressor of cytokine signaling 3 (SOCS3) protein. This antibody has been extensively studied and has shown great potential in various research applications.</p>

<p>Purified Polyclonal RAB11FIP4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPM3 antibody, catalog no. 70R-4890</p>

<p>Please enquire for more information about Murine Anti-HIV-1 p24 monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Murine Anti-HIV-1 p24 monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>E. coli-derived recombinant human IFN-β</p>

<p>Rat monoclonal Flk1 antibody (biotin)</p>

<p>Research Peptide</p>

<p>Rabbit Polyclonal Tyrosine Hydroxylase antibody (Ser40)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HRG antibody, catalog no. 70R-5345</p>

<p>Rabbit polyclonal CYP24A1 antibody</p>

<p>The TYRO3 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been developed to specifically target and neutralize the TYRO3 protein, which plays a crucial role in various cellular processes. By binding to TYRO3, this antibody effectively inhibits its function and can be used for a wide range of applications.</p>

<p>GPS2 antibody was raised in Rabbit using Human GPS2 as the immunogen</p>

<p>Purified recombinant YAE1D1 protein (His tag)</p>

<p>80-273 amino acids: MGSSHHHHHH SSGLVPRGSH MQVQRRKWKL NLIAELESRV LAEPVPLPAD PMELKNLEYR PVKVRGCFDH SKELYMMPRT MVDPVREARE GGLISSSTQS GAYVVTPFHC TDLGVTILVN RGFVPRKKVN PETRQKGQIE GEVDLIGMVR LTETRQPFVP ENNPERNHWH YRDLEAMARI TGAEPIFIDA NFQSTVPGGP IGGQTRVTLR NEHLQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CBX6 antibody, catalog no. 20R-1213</p>

<p>Rabbit polyclonal SOCS6 antibody</p>

<p>Alkyne-Agarose targets azide-modified proteins with an activation level of 10-20 umol alkyne groups per mL resin.  <br>Alkyne-Agarose is a 6% crosslinked agarose resin that is activated with terminal alkyne functional groups for covalent capturing azide-tagged biomolecules. This product is adequate to work in batch or column purification (low pressure).</p>

<p>Mucin is majorly composed of carbohydrate units, the monomer of mucin being about 640 kDa.</p>

<p>NH2-dPEG®4-Glu(OH)-NH-dPEG®4-Glu(OH)-NH-m-dPEG®24 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>NHS-m-dPEG® (MW = 685) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-m-dPEG® (MW = 685) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Ebastine-d5 is a selective inhibitor of the histamine H1 receptor. It binds to the ligand binding site of the H1 receptor and blocks the activity of this receptor. This drug has been shown to be an effective treatment for allergic rhinitis, chronic urticaria, and other allergic conditions. Ebastine-d5 is used in research as a tool to study protein interactions and receptor function.</p>

<p>Epelsiban is an oxytocin receptor antagonist, which is a chemically synthesized compound. It functions by selectively blocking the oxytocin receptor, thereby inhibiting the effects mediated by oxytocin, a naturally occurring hormone involved in uterine contractions. This mode of action is particularly significant in the context of managing preterm labor.</p>

<p>VER-49009 is a small molecule amide that inhibits chaperones. Chaperones are proteins that function in the cell to suppress protein aggregation and facilitate protein folding. VER-49009 has been shown to inhibit the heat-shock protein HSP90 and the chaperone Hsp70, which are important for cancer progression. The compound also has an anticancer effect on human ovarian carcinoma cells in vitro and in vivo. The localization of VER-49009 is not yet known, but it may be present in tissues with high levels of HSP90 or Hsp70.</p>

<p>4-Chloro-7-nitroquinoline-3-carbonitrile is a research tool that is used to study the interaction of proteins. It can bind to ligands and receptors, which may lead to changes in cell biology. 4-Chloro-7-nitroquinoline-3-carbonitrile is also used as a reagent in immunology and pharmacology studies. 4CNC has been shown to inhibit ion channels and other protein functions. It has high purity and can be used for the production of peptides or antibodies.</p>

<p>Thiopilocarpine is a muscarinic receptor agonist that is used in the treatment of insulin resistance and metabolic disorders. It has been shown to modulate acetylcholine concentration-response curves in tissues, and can be used as an aid in diagnosing these conditions. Thiopilocarpine also binds to the muscarinic M1 receptor and stimulates leukotriene D4 production. This drug does not cross the blood-brain barrier, which limits its use in treating neurological disorders.</p>

<p>1-Methylestrone is a chemical compound with the molecular formula C14H18O2. It is an estrogenic metabolite of estradiol, and is formed from the metabolism of estradiol by CYP1A2 and other cytochrome P450 enzymes. 1-Methylestrone has been shown to be an activator of certain estrogen receptors, such as ERα and ERβ, in breast cancer cells. 1-Methylestrone also has been shown to inhibit the production of cyclic AMP by phosphodiesterase 4B (PDE4B) in prostate cancer cells, which may be due to its ability to inhibit protein interactions.</p>

<p>TLR7-agonist-1 is a linker that can be used to synthesize pyrimidine compounds. It is a crystalline form of TLR7-agonist-1, which can be prepared by reacting benzyl trifluoroacetate with the compound in the presence of an organic solvent in the presence of a base. This compound has been shown to have receptor activity and to stimulate TLR7 in cells. The biological effects of this compound are similar to those of oligonucleotides, although it does not exhibit any cytotoxic properties. The synthesis process for TLR7-agonist-1 is relatively easy and it can be prepared from readily available starting materials such as nucleic acids.</p>

<p>5-[[5-(2,4-Dichlorophenyl)furan-2-yl]methylidene]-2-sulfanylidene-1,3-diazinane-4,6-dione is a peptide that has been shown to inhibit the binding of an antibody with its antigen and to have a high affinity for the ligand. It also inhibits ion channels and activates receptors. 5-[(5-(2,4-Dichlorophenyl)furan-2-yl)methylidene]-2-sulfanylidene 1,3 diazine 4,6 dione is a potent inhibitor of ligand binding to the receptor. The inhibition is competitive and reversible. 5-[(5-(2,4-Dichlorophenyl)furan-2-yl)methylidene]-2 sulfanylidene 1,3 diazine 4,6 dione can be used as an inhibitor in pharmac</p>

<p>SPDP-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Please enquire for more information about ACTH (1-16), human including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>JMC-4 is a novel anti-inflammatory agent that belongs to the class of lipoxygenase inhibitors. It is an optimized conformation of JMC-1 and has shown covalent binding to lipoxygenase with high affinity. JMC-4 has been shown to inhibit lipoxygenase activity in a blood assay and in fruit extracts. The molecular electrostatic potential of JMC-4 was calculated using QM/MM calculations and its active conformation was determined by X-ray crystallography. The conformational change in the active conformation of JMC-4 is due to the formation of hydrogen bonds with neighboring molecules, leading to a more hydrophobic environment for the active site.</p>

<p>Bromoacetamido-dPEG®23-Azide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®23-Azide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>MMAF sodium is a highly specialized payload used in the development of antibody-drug conjugates (ADCs). It is derived from the synthetic modification of the cytotoxic agent monomethyl auristatin F, which itself originates from dolastatin 10, a compound produced by marine organisms. The mechanism of action of MMAF sodium involves the inhibition of tubulin polymerization. This disruption of the microtubule network effectively halts cell division, leading to apoptosis in rapidly dividing cancer cells.</p>

<p>Vabicaserin hydrochloride is a potent and selective 5-HT2C receptor antagonist. It is used as a treatment for obesity, type 2 diabetes, or neuropathic pain due to its effects on the serotonergic system. This drug inhibits the production of glucose by inhibiting the sodium-dependent glucose transporter in rat liver microsomes. Vabicaserin hydrochloride has been shown to inhibit the activity of 5-HT1A receptors in vitro assays and has an inhibitory effect on infectious diseases and autoimmune diseases. This drug also increases dopamine release in striatal tissues via inhibition of dopamine reuptake.</p>

<p>OXA-01 is a monoclonal antibody that targets the protein phosphatase 2A (PP2A), which are enzymes that regulate cell growth. OXA-01 has been shown to be effective in reducing tumor growth and inhibiting angiogenesis, which may contribute to its anti-inflammatory properties. It has also been shown to be more potent than rapamycin, an immunosuppressant drug used in cancer therapy, with less side effects. OXA-01's mechanism of action is still unknown, but it is believed that this drug may inhibit the function of PP2A by binding to a specific site on the enzyme and blocking its activity. The effectiveness of this drug on various cancers, including carcinoma cell lines, has been shown through in vivo analysis.</p>

<p>TUG-1375 is a highly selective, potent antagonist of the GPR40 (FFAR1) receptor, which is a G-protein-coupled receptor predominantly expressed in pancreatic β-cells. This receptor plays a critical role in mediating free fatty acid-induced insulin secretion. TUG-1375 is sourced from advanced chemical synthesis techniques that ensure both purity and specificity.</p>

<p>Pan-caspase inhibitor</p>

<p>AMG-3969 is a piperazine derivative with a potent profile that inhibits the gluconeogenic enzymes. It has been shown to have regulatory effects on pancreatic cells and animals in vitro and in vivo. AMG-3969 is also effective at inhibiting uptake of glucose from the blood by cells in vitro, which may lead to antidiabetic effects. It is also synthesized using an asymmetric synthesis, making it a unique molecule that has not been seen before. The safety profile of AMG-3969 has been demonstrated in preclinical studies.</p>

<p>ELND006 is a secretase inhibitor that inhibits the activity of acetylcholine esterase by binding to the active site. It has been shown to have potential as a treatment for Alzheimer's disease and other neurological disorders. ELND006 has also been shown to be effective against viruses such as herpes simplex virus type 1 (HSV-1) and rabies virus, which are known to cause dementia in infected people. ELND006 is currently being developed for use in humans as a potential therapy for patients with diseases associated with synaptic dysfunction.</p>

<p>α-Phenyllongifolol is a sesquiterpenoid compound, which is derived primarily from certain plant species known for their essential oil production. This compound is biosynthesized through the mevalonate pathway, a critical metabolic route in plants responsible for terpene production. The mode of action of α-Phenyllongifolol involves disrupting microbial cell membranes, exhibiting potent antimicrobial properties. It interferes with the lipid bilayer, leading to increased permeability and, subsequently, cell death.</p>

<p>Br-PBTC is a potentiator of the effects of estradiol. It has been shown to have allosteric modulating activity on α subunit nicotinic acetylcholine receptors, which are involved in the pharmacological effect of Br-PBTC. The sequence analysis of the receptor revealed that Br-PBTC interacts with 17β-estradiol and enhances its binding affinity to the receptor. This interaction may be due to an increase in the number of estradiol molecules bound to the receptor, or by increased conformational changes induced by Br-PBTC at the receptor site.</p>

<p>ITIC is a low energy dye with a wide absorption band in the visible region. ITIC has been used to detect fatty acids and cholesterol, as well as other molecules like human serum albumin, hemoglobin, and proteins. The molecule can be detected using laser ablation-inductively coupled plasma-mass spectrometry (LA-ICPMS) and x-ray absorption spectroscopy (XAS). The detection sensitivity of ITIC is much higher than that of other dyes. The chemical stability of ITIC has been shown by its photostability, which means it does not degrade when exposed to light. ITIC can be used for many applications such as for detecting fatty acids in milk or for determining the concentration of cholesterol in blood samples.</p>

<p>[Pyr1]apelin-13 (human) (CAS: 217082-60-5)</p>

<p>Bromoacetamido-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>NHS-m-dPEG® is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-m-dPEG® is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Bromoacetamido-dPEG®12-Amido-DBCO is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Bromoacetamido-dPEG®12-Amido-DBCO is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methotrexate is a drug that suppresses the immune system by inhibiting the production of white blood cells. It is used in the treatment of a number of diseases, including some cancers and autoimmune diseases such as rheumatoid arthritis and psoriasis. Methotrexate is metabolized to its active form, methotrexate, by an enzyme called dihydrofolate reductase (DHFR). The DHFR inhibitor activity of methotrexate blocks the synthesis of folate-dependent enzymes and prevents DNA synthesis in rapidly dividing cells. Methotrexate has been used in combination with other drugs to treat cancer. Methotrexate has also been shown to have antifungal properties against opportunistic fungal infections.</p>

<p>Edelfosine is a phospholipid analog that has been shown to inhibit insulin-induced glucose uptake in adipocytes. It is a potent inhibitor of the insulin receptor tyrosine kinase and can also act as an allosteric inhibitor of protein kinase C (PKC). Edelfosine inhibits the growth of mammary carcinomas by inhibiting PKC, which leads to a decrease in cell proliferation. This drug also interacts with sulfonic acids, forming hydrogen bonds, which may be the reason for its high-performance liquid chromatography. The molecular weight of edelfosine is 582.3 g/mol.</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Val-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R,S)-AMPA is a synthetic analog of the excitatory neurotransmitter glutamate, specifically designed to activate AMPA receptors, a subtype of ionotropic glutamate receptors. These receptors are pivotal in mediating fast synaptic transmission in the central nervous system. (R,S)-AMPA serves as a prototypical agonist for AMPA receptors, facilitating the study of receptor function and synaptic plasticity.​</p>

<p>Z-Leu-Leu-Arg-AMC is a proteolytic substrate that is used to study the activation of Th17 cells. It activates these cells by binding to the antigen peptide and protease activity, which are involved in the immune response. Z-Leu-Leu-Arg-AMC has been shown to induce autoimmune diseases in mice, as well as other conditions such as chronic inflammation and obesity. This compound also has a potential drug target for neutralizing acidity, which could be useful in treating cancer and other diseases. Z-Leu-Leu-Arg-AMC is stable at acidic pHs and can be used for biochemical studies of proteases at acidic pHs.</p>

<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Acetate salt; GLP-1, GIP, and GCGR2 mimic; Obesity research</p>

<p>Dapta is a basic protein that belongs to the group of long-chain polyamines. It is synthesized from the amino acid, putrescine and serves as a precursor for the synthesis of other polyamines. Dapta is also known to have biological properties such as long-term toxicity, neuronal death, and inhibition of cancer growth in mice. The polymerase chain reaction (PCR) technique has been used to show that dapta is expressed in atherosclerotic lesions and has a role in inflammatory responses. Dapta inhibits tumor necrosis factor-α (TNF-α) production through toll-like receptor 4 (TLR4), leading to reduced inflammation.</p>

<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-Gln-OH is an amide that is a major metabolite of the hormone prolactin. It is generated by deamination, which converts the amino acid histidine to H-Ile-Gln-OH. H-Ile-Gln-OH has been shown to have an antiinflammatory effect on colitis and cardiac reperfusion injury. Its mechanism of action may be due to its ability to inhibit proinflammatory cytokines such as IL1β and TNFα.</p>

<p>Please enquire for more information about Amyloid beta-Protein (11-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Asp1)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Peroxisome proliferator-activated receptor PPARβ/Ύ agonist</p>

<p>4-Alkoxybenzyl alcohol resin is a fine chemical that has been shown to be useful as a scaffold for the synthesis of complex compounds. It is soluble in common organic solvents, such as ethanol and acetone, and can be used as a reaction component for the synthesis of speciality chemicals. This product is also an intermediate for research chemicals, which can be synthesized by reacting 4-alkoxybenzyl alcohol with different reagents. The high quality of this product makes it ideal for use in the synthesis of other compounds and reactions.</p>

<p>VU0453379 is a chemical compound that functions as a positive allosteric modulator (PAM) of the M4 muscarinic acetylcholine receptor. It is synthetically derived through medicinal chemistry processes designed to selectively enhance receptor signaling pathways. VU0453379 acts by binding to an allosteric site on the M4 receptor, distinct from the orthosteric site where endogenous neurotransmitters bind. This binding potentiates receptor sensitivity and activity in response to acetylcholine, thereby amplifying receptor-mediated signaling pathways.</p>

<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>

<p>Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galacto-RGD trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Gly-Arg-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.</p>

<p>H-Pro-Phe-OH is a synthetic peptide that is used in the treatment of high blood pressure. It has been shown to decrease blood pressure by increasing the production of nitric oxide and by decreasing activity of angiotensin converting enzyme, which are factors that have an influence on blood pressure. H-Pro-Phe-OH has been shown to be effective for treating HIV infection and amyloidosis. H-Pro-Phe-OH binds to collagen and increases its production in tissues, which may be responsible for its antihypertensive effects. It also inhibits the growth of bacteria by binding to their cell walls and inhibiting their protein synthesis. The metabolic products of H-Pro-Phe-OH are not yet known, but it is thought that they may contain hydroxyproline or hydroxylysine residues.</p>

<p>Hippuryl-His-Leu-OH is a peptide that inhibits the activity of angiotensin converting enzyme (ACE) at a concentration of 50 μM. It has been shown to inhibit cyclase and other enzymes in vitro. The binding of this compound to ACE prevents the conversion of angiotensin I to angiotensin II, which is a potent vasoconstrictor. Hippuryl-His-Leu-OH also has inhibitory properties against atrial natriuretic peptide (ANP), and can be used as an antihypertensive agent. This drug has been shown to have growth factor β1 activities, and can be used for the treatment of cardiac diseases such as myocardial infarction. Structural analysis shows that this drug binds to the active site of ACE, inhibiting its activity by blocking access to substrate or by altering substrate specificity.</p>

<p>Please enquire for more information about Acetyl-(D-Arg2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A2A adenosine receptor antagonist</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>ARV-471 is an anticancer drug that acts as a Chinese hamster ovary (CHO) cell inhibitor. It is a potent and selective kinase inhibitor that has been shown to induce apoptosis in cancer cells. ARV-471 is a protein analog of nifedipine, which is a calcium channel blocker used to treat high blood pressure and angina. This drug works by inhibiting kinases, which are enzymes that regulate cellular growth and proliferation. ARV-471 has been demonstrated to be effective in treating various types of cancer, including breast cancer, by inhibiting the growth of tumor cells and inducing apoptosis. Its unique mechanism of action makes it a promising candidate for future cancer therapies.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Selective and potent inhibitor of lysine acetyltransferases KAT6A and KAT6B with IC50 values in low nanomolar range. The compound is a reversible competitor of acetyl coenzyme A domain of KAT6A/B enzymes. It inhibits MYST-catalysed histone acetylation and was shown to arrest lymphoma progression in mice models. The compound opened the door to a new class of cancer therapeutics that could potentially direct the cancer cells in senescence or permanent dormancy.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-Tyr(tBu)-Ser(Psi(Me,Me)Pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ipatasertib is a drug that belongs to the class of inhibitors of the ATP-binding cassette (ABC) transporter protein P-glycoprotein. It prevents the efflux of drugs from cancer cells, thereby increasing their concentration in tumor tissue. Ipatasertib has been shown to be effective against eye disorders with minimal toxicity in vitro and in vivo. The drug binds to the bicylcic heterocycle as a result of its activity as an ATPase inhibitor and blocks tumor growth by inhibiting receptor activity.</p>

<p>Please enquire for more information about Myelin Oligodendrocyte Glycoprotein (35-55) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>