Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,570 products)
- By Biological Target(100,766 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(477 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
H-K^TSAVLQSGFRKME-OH
Peptide H-K^TSAVLQSGFRKME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLRKGYAPLMETGLS-OH
H-RLRKGYAPLMETGLS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-RLRKGYAPLMETGLS-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-RLRKGYAPLMETGLS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-RLRKGYAPLMETGLS-OH at the technical inquiry form on this page
Purity:Min. 95%H-D-Tyr-Val-NH2
CAS:H-D-Tyr-Val-NH2 is a regulatory group that acts as the prosthetic group for a number of peptidyl and peptide hormones. H-D-Tyr-Val-NH2 is also involved in catalytic mechanism, as it is the amino acid responsible for the formation of peptide bonds in proteins. H-D-Tyr-Val-NH2 is found in high concentrations in the cerebriform tissue and has been shown to be important for the biosynthesis of amides, which are prohormones. H-D-Tyr-Val NH2 also participates in a number of cellular reactions, including those that have a kinetic rate.Formula:C14H21N3O3Molecular weight:279.33 g/molRSV antibody
RSV antibody was raised in mouse using fusion protein of RSV, types A and B as the immunogen.H-Ile-Asn-OH
CAS:H-Ile-Asn-OH is a chloroplastic amide that is used as a substrate in polymerase chain reactions. It can be used to study the structure of proteins and enzymes by the use of monoclonal antibodies. H-Ile-Asn-OH has been sequenced and assayed, and found to have high binding affinity for carboxylate groups. This chemical has been shown to have multidomain structures as well as an isotype that is specific for triticum aestivum. H-Ile-Asn-OH may also be involved in plant physiology due to its role in photosynthesis.Formula:C10H19N3O4Molecular weight:245.28 g/molHSV-1 Antigen
HSV-1 Antigen is a life science tool for use in IVD applications. Please enquire for more information about HSV-1 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH
Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MEK162
CAS:Inhibitor of MEK1/2 kinase enzymes; antineoplasticFormula:C17H15BrF2N4O3Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:441.23 g/molH-Lys-D-Trp-Phe-D-Trp-Leu-Leu-NH2
H-Lys-D-Trp-Phe-D-Trp-Leu-Leu-NH2 is a potent full inverse agonist for the Ghrelin Receptor. Ghrelin is a peptide hormone that stimulates GH release from the anterior pituitary gland. Ghrelin also has other functions in the body. It binds to the ghrelin receptor and increases appetite and gastric motility. Ghrelin can also stimulate insulin secretion from pancreatic beta cells. Ghrelin levels are high before meals and decrease after eating.
Formula:C49H66N10O6Purity:Min. 95%Molecular weight:891.14 g/molH-IYPTNGYTR-OH
H-IYPTNGYTR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IYPTNGYTR-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IYPTNGYTR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IYPTNGYTR-OH at the technical inquiry form on this page
Purity:Min. 95%H-K^TSAVLQ-OH
Peptide H-K^TSAVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tadocizumab
CAS:Anti-IL-6 receptor humanized whole antibody, immunosuppressive drug, treatment of rheumatoid arthritis, systemic juvenile idiopathic arthritis and COVID-19Tetrabenazine - Bio-X ™
CAS:Controlled ProductTetrabenazine is a drug that has been used for the treatment of Parkinson's disease. It acts by inhibiting dopamine release and reducing the activity of nerve cells in the brain. Tetrabenazine Bio-X is used to treat dyskinesias, that are abnormal and involuntary muscle movements by inhibiting the monoamine transporter (VMAT2). Tetrabenazine is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use."Formula:C19H27NO3Purity:Min. 99 Area-%Color and Shape:White PowderMolecular weight:317.42 g/molGBM Antibody Positive Human Plasma
GBM Antibody Positive Human Plasma is an antigen for use in IVD applications. Please enquire for more information about GBM Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.Ac-AAGAMFLEA-NH2
Ac-AAGAMFLEA-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-AAGAMFLEA-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-AAGAMFLEA-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-AAGAMFLEA-NH2 at the technical inquiry form on this page
Purity:Min. 95%Jo-1 Antibody Positive Human Plasma
Jo-1 Antibody Positive Human Plasma is an antigen for use in IVD applications. Please enquire for more information about Jo-1 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.H-Cit-AMC·HBr
CAS:Please enquire for more information about H-Cit-AMC·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H20N4O4·HBrPurity:Min. 95%Color and Shape:SolidMolecular weight:413.27 g/molAc-Gln-Phe-Phe
Peptide Ac-QFF-H is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C23H28N4O5Molecular weight:440.49 g/molCMVpp65 - 36 (HLPVADAVIHASGKQ)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,542.8 g/molH-TTAVPWNTSWSNKSL-OH
H-TTAVPWNTSWSNKSL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TTAVPWNTSWSNKSL-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TTAVPWNTSWSNKSL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TTAVPWNTSWSNKSL-OH at the technical inquiry form on this page
Purity:Min. 95%H-SLPASLQR-OH
H-SLPASLQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SLPASLQR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SLPASLQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SLPASLQR-OH at the technical inquiry form on this page
Purity:Min. 95%Human Serum From Patients With Small Cell Lung Cancer (SCLC)
Please enquire for more information about Human Serum From Patients With Small Cell Lung Cancer (SCLC) including the price, delivery time and more detailed product information at the technical inquiry form on this page
SSB Antibody Positive Human Serum
SSB Antibody Positive Human Serum is an antigen for use in IVD applications. Please enquire for more information about SSB Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.PR3 Antibody Positive Human Plasma
Please enquire for more information about PR3 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page
...β-2-Glycoprotein-1 IgG Positive Serum
...Beta-2-Glycoprotein-1 IgG Positive Serum is an antigen for use in IVD applications. Please enquire for more information about ...Beta-2-Glycoprotein-1 IgG Positive Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.Bemarituzumab
CAS:Humanized, afucosylated IgG1 monoclonal antibody targeting fibroblast growth factor receptor 2b (FGFR2b)H-LLIYDASNLETGVPSR^-OH
Peptide H-LLIYDASNLETGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Glial Fibrillary Acidic Protein (GFAP), Recombinant
Glial Fibrillary Acidic Protein (GFAP), Recombinant is a life science tool for use in IVD applications. Please enquire for more information about Glial Fibrillary Acidic Protein (GFAP), Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.Purity:>90% By Sds-Page.TARDBP antibody
TARDBP antibody was raised in mouse using recombinant human TARDBP (1-260aa) purified from E. coli as the immunogen.H-VYLATNVFL-OH
H-VYLATNVFL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VYLATNVFL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VYLATNVFL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VYLATNVFL-OH at the technical inquiry form on this page
Purity:Min. 95%H-DL^AFPGSGEQV^EK-OH
Peptide H-DL^AFPGSGEQV^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice....β-2-Glycoprotein-1 IgM Positive Serum
...Beta-2-Glycoprotein-1 IgM Positive Serum is an antigen for use in IVD applications. Please enquire for more information about ...Beta-2-Glycoprotein-1 IgM Positive Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.H-DDNPNLPR^-OH
Peptide H-DDNPNLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Urine From Pregnant Women
Urine From Pregnant Women is an antigen for use in IVD applications. Please enquire for more information about Urine From Pregnant Women including the price, delivery time and more detailed product information at the technical inquiry form on this page.H-KQLVIYEEISDPEEDDE-OH
H-KQLVIYEEISDPEEDDE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KQLVIYEEISDPEEDDE-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KQLVIYEEISDPEEDDE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KQLVIYEEISDPEEDDE-OH at the technical inquiry form on this page
Purity:Min. 95%Dabcyl-SFNFPQIT-Edans
Peptide Dabcyl-SFNFPQIT-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Loxoprofen sodium - Bio-X ™
CAS:Loxoprofen is a non-steroidal anti-inflammatory drug that belongs to the group of propionic acid derivatives. It can be used for the treatment of pain and inflammation associated with osteoarthritis, rheumatoid arthritis and other musculoskeletal disorders. Its therapeutic effects are attributed to inhibition of cyclooxygenases 1 and 2 (COX-1 and COX-2) enzymes.Formula:C15H18O3•NaPurity:Min. 95%Color and Shape:PowderMolecular weight:269.29 g/molH-HNTTVFQGVAGQSLQVSCPY-OH
H-HNTTVFQGVAGQSLQVSCPY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HNTTVFQGVAGQSLQVSCPY-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HNTTVFQGVAGQSLQVSCPY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HNTTVFQGVAGQSLQVSCPY-OH at the technical inquiry form on this page
Purity:Min. 95%CHRNA4 antibody
CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTPurity:Min. 95%
