Biochemicals and Reagents

<p>CKMB antibody was raised in mouse using purified human CK-MB as the immunogen.</p>

<p>H-ANEGTVGVSAATER-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ANEGTVGVSAATER-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ANEGTVGVSAATER-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ANEGTVGVSAATER-OH at the technical inquiry form on this page</p>

<p>BID (BH3 Interacting Domain Death Agonist) is a pro-apoptotic protein and a member of the BH3-only family, which is part of the larger Bcl-2 family of proteins. BID plays a critical role in the regulation of apoptosis (programmed cell death) by linking two major pathways that trigger cell death: the extrinsic (death receptor-mediated) and intrinsic (mitochondria-mediated) pathways.BID is typically present in an inactive form in the cytosol. In response to death signals from the extrinsic apoptotic pathway, such as when death receptors (e.g., Fas or TNF receptors) are activated, BID gets cleaved by caspase-8. This cleavage produces a truncated, active form of BID called tBID (truncated BID).<br>Once activated, tBID translocates to the mitochondria, where it interacts with pro-apoptotic Bcl-2 family proteins like Bax and Bak. This interaction causes mitochondrial outer membrane permeabilization (MOMP), leading to the release of cytochrome c and other apoptogenic factors from the mitochondria into the cytosol. The release of cytochrome c activates the caspase cascade, which ultimately leads to the execution of apoptosis.</p>

<p>Please enquire for more information about Cy5 DiC18 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cy5 SE(tri SO3) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cy5.5 Di Et including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>JAG-1(188-204). Jagged - 1 is a cell surface ligand for in the Notch pathway. Notch receptors and ligands are present on the extracellular service of cells and require cell-cell contact for engagement. Ligand binding to Notch receptors results in the proteolytic cleavage of membrane-bound Notch receptors, thus allowing the intercellular region to be transported to the nucleus and become a transcriptional activator. The ligand-induced Notch activation is regulated by E3 ubiquitin ligases, Mindbomb1 (Mib-1) and Neuralized.JAG1 is widely expressed throughout mammalian development, across many tissues and developmental stages. Notch signalling plays a critical role in cellular fate determination including muscle cell differentiation, neurogenesis, and the development of the sensory regions of the inner ear- heart- kidney- eye- lung and other tissues.Jag-1 has been implicated in breast- cervical- colorectal- endometrial- gastric- head and neck- ovarian- hepatocellular- lung- pancreatic- prostate, and kidney and adrenocortical cancers, leukemia and lymphoma. Co-overexpression of Notch-1 and Jagged-1 predicts the poorest overall cancer survival. JAG1 mutations have also been associated Alagille syndrome.</p>

<p>H-VFLAQPPSGQRR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VFLAQPPSGQRR-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VFLAQPPSGQRR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VFLAQPPSGQRR-OH at the technical inquiry form on this page</p>

<p>Peptide H-EEMQRR^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Biotin gliadin-derived peptides derived from Gliadin peptides, the component of wheat involved in the gastrointestinal symptoms of wheat allergy and Celiac Disease (CD). During wheat allergies histamines and leukotrienes are secreted due to gliadin peptide sequences cross-linking two IgE molecules on mast cells and basophils.The glutamine and proline rich peptides of which Gliadin is composed of are resistant to proteolysis during digestion, leaving them active in the gastrointestinal tract. Subsequently these are deamidated by tissue transglutaminase and can bind to HLA-DQ2 or DQ8. As a result in patients with the autoimmune disease CD, there is a Th-mediated inflammatory immune response against these gliadin peptides.Gliadin can exert additional effects on the intestinal microbiota and ileal barrier function. It has been found that gut microbiota members such as Bifidobacterium and lactobacillus have the ability to digest and inactivate gliadin peptides hence reducing their inflammatory effects in the gastrointestinal system.Here Biotin (B7) has been added. Biotin is a cofactor for several mammalian biotin-dependent carboxylases which are involved in processes such as gluconeogenesis, amino acid metabolism and fatty acid synthesis.</p>

<p>Nuclear receptor binding SET domain (NSD) 3 antagonist; selectively binds PWWP1</p>

<p>Peptide H-G^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CA 19-9 (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 19-9 (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>This sequence corresponds to the peptide bond between mammalian Lys11- (K11) linked Ub proteins- where (GG) corresponds to the C-terminus of the side chain appended Ub.Chains containing Lys11 (K11) Ub linkages are considered atypical. However they have been implicated in a range of cellular pathways. K11-Linked Ub, assembled via the ubiquitin ligase: anaphase-promoting complex/cyclosome (APC/C), regulate cell cycle progression via targeting proteins to the proteasome. K11 ubiquitin linkages are also involved in maintaining endoplasmic reticulum homeostasis and maintaining cellular protein homeostasis and have been discovered in protein aggregates found in neurodegenerative diseases, such as Alzheimer's disease and Huntington's disease.</p>

<p>Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Methotrexate is a chemotherapeutic and immunosuppressive medication, which is a synthetic analog of folic acid. Its source is through chemical synthesis, mimicking the structure of dihydrofolate in order to exert its effects. Methotrexate acts primarily by inhibiting the enzyme dihydrofolate reductase (DHFR), leading to a decrease in tetrahydrofolate production. This disruption in folate metabolism results in the inhibition of DNA, RNA, and protein synthesis, which affects rapidly dividing cells.Methotrexate is employed broadly in clinical oncology as an antineoplastic agent, particularly in the treatment of leukemias, lymphomas, breast cancer, and osteosarcoma. Additionally, it serves as a cornerstone for managing autoimmune diseases such as rheumatoid arthritis and psoriasis, where it helps modulate the aberrant immune response. The dual role of Methotrexate in oncology and immunosuppression underscores its versatility and critical importance in therapeutic regimens. However, its use demands careful monitoring due to potential adverse effects on non-cancerous cells and organ systems, necessitating precise dosage management and patient evaluation.</p>

<p>A glycogen synthase kinase 3β- (GSK3β-) / crosstide fragment representing the phosphorylation site on GSK3β-. GSK3β- is a serine/threonine kinase which regulates glycogen synthase activity and is a key mediator of vertebrate development, tumourigenesis and cell differentiation. GSK3β- is phosphorylated by activated AKT/protein kinase B on serine 9- promoting its inactivation.</p>

<p>H-LGIWGCSGKHICTTN-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LGIWGCSGKHICTTN-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LGIWGCSGKHICTTN-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LGIWGCSGKHICTTN-OH at the technical inquiry form on this page</p>

<p>MK 2206 is an allosteric inhibitor acting on the protein kinase B (AKT) signaling pathway. MK 2206 acts as an inhibitor in a non-ATP competitive way. MK 2206 has been investigated for clinical use against various types of cancer in which drug resistance is encountered.</p>

<p>Tiapride is a dopamine receptor antagonist that is used in the treatment for anxiety and chorea in Huntington’s disease. It also is used to ease agitation in elderly patients. Although its mechanism of action is not fully understood, this drug is believed to modulate dopamine receptors in the brain, particularly D2 and D3 receptors, which can help regulate dopamine transmission and balance in the central nervous system.</p>

<p>Specific inhibitor of the mitochondrial pyruvate carrier complexes MPC1 and MPC2. The compound blocks the pyruvate transport across the inner mitochondrial membrane and therefore reduces pyruvate influx into the gluconeogenesis. It supresses glucose production in hepatocytes and was proposed for the control of hyperglycaemia in diabetic patients. Also used for the sensitisation of cancer cell lines to chemotherapy.</p>

<p>Please enquire for more information about D-Erythro-sphingosine-C20-1-phosphate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-SYSTTAVVTNC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-SYSTTAVVTNC-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-SYSTTAVVTNC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-SYSTTAVVTNC-NH2 at the technical inquiry form on this page</p>

<p>Diflunisal is a nonsteroidal anti-inflammatory drug (NSAID), which is a synthetic derivative of salicylic acid. It is primarily sourced through chemical synthesis rather than extraction from natural elements. Diflunisal functions by inhibiting the cyclooxygenase (COX) enzymes, specifically COX-1 and COX-2, which play a crucial role in the biosynthesis of prostaglandins. This inhibition results in reduced production of prostaglandins, compounds involved in inflammation and pain signaling pathways.</p>

<p>Peptide Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. The nucleoprotein has a critical role in virus assembly and RNA transcription. The nucleoprotein is essential in the formation of helical ribonucleoproteins and in regulating viral RNA synthesis. The nucleoprotein can also regulate infected host cellular mechanisms. It is highly expressed during infection and may induce protective immune responses against SARS-CoV and SARS-CoV-2.The nucleoprotein residues GMEVTPSGTWLTYTG (321-335) from SARS-CoV-2 have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.</p>

<p>The SOD1 homodimer forms a β-barrel and contains an intramolecular disulphide bond and a binuclear Cu/Zn site in each subunit. This Cu/Zn site holds a copper and zinc ion and is responsible for catalysing the disproportionation of ROS, namely superoxide to hydrogen peroxide and dioxygen. In binding to copper and zinc ions, SOD1 is one of three superoxide dismutases responsible for destroying free superoxide radicals.The clinical relevance of SOD1 is related to its function in regulating ROS in the mitochondria of cells. Most notably, SOD1 is a crucial enzyme involved in ROS release during oxidative stress by ischemia-reperfusion injury, specifically in the myocardium as part of ischemic heart disease. During ischemia reperfusion, ROS release substantially contribute to the cell damage and death via a direct effect on the cell as well as via apoptotic signals. SOD1 is known to have a capacity to limit the detrimental effects of ROS. As such, SOD1 is important for its cardioprotective effects.</p>

<p>Human IgG gamma antibody was raised in sheep using human IgG (Fc Fragment) as the immunogen.</p>

<p>HIV1 rev antibody was raised in sheep using glutathione-S-transferase fusion protein expressed in vitro as the immunogen.</p>

<p>Picrotoxin is a GABA-A receptor antagonist that is used to relieve respiratory distress. This drug also is used as an antidote from poisoning by CNS depressants. Picrotoxin works by blocking the GABA activated chloride ionophore.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Human Serum Albumin, 20% solution</p>

<p>Histone H3 (1-20) K4Me3 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Lysine 4 of H3 (1-20) has been tri-methylated.</p>

<p>Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.</p>

<p>Purified Native Mouse Transferrin protein</p>

<p>Peptide H-QLIDIVDQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Avidin antibody (HRP) was raised in rabbit using avidin isolated from hen egg white as the immunogen.</p>

<p>Peptide Ac-EEQYNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Haptoglobin antibody was raised in rabbit using human haptoglobin as the immunogen.</p>

<p>Peptide LCBiot-GDGNSVLKPGNW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Histone H3 (1-18) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.</p>

<p>Arginase antibody was raised in rabbit using arginase isolated from bovine liver as the immunogen.</p>

<p>HBsAg antibody was raised in mouse using highly purified hepatitis B surface antigen as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GLSPTVWLSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Activater of the Nrf2 pathway and an inhibitor of the NF-κB pathway.  Possible applications have extended to anti-viral treatment of COVID-19.</p>

<p>CMV pp65 tegument protein antibody was raised in mouse using UL83 (pp65) of Cytomegalovirus as the immunogen.</p>

<p>Peptide H-GSPAINVAMHVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ</p>