
Carboxylic Acids
Found 12457 products of "Carboxylic Acids"
N,N'-Dibenzylethylenediamine diacetate
CAS:Controlled ProductN,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.Formula:C16H20N2•(C2H4O2)2Purity:Min. 95%Molecular weight:360.45 g/molAc-Val-Glu-His-Asp-AFC trifluoroacetate salt
CAS:Please enquire for more information about Ac-Val-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C32H36F3N7O11Purity:Min. 95%Molecular weight:751.66 g/molAmyloid b-Protein (1-40) amide trifluoroacetate salt
CAS:Please enquire for more information about Amyloid b-Protein (1-40) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C194H296N54O57SPurity:Min. 95%Molecular weight:4,328.82 g/mol17-alpha,21-Dihydroxy-16-a-methylpregna-1,4,9(11)-triene-3,20-dione 21-acetate
CAS:Controlled ProductPlease enquire for more information about 17-alpha,21-Dihydroxy-16-a-methylpregna-1,4,9(11)-triene-3,20-dione 21-acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C24H30O5Purity:Min. 95%Molecular weight:398.49 g/mol4-(Dodecyloxy)benzoic Acid
CAS:4-(Dodecyloxy)benzoic acid is a white crystalline solid that can be synthesized from triazine, fatty acid, and 4-hydroxyphenylacetic acid. It has been found to be an efficient photosensitizer for the generation of singlet oxygen in organic systems. The photochemical properties of this compound have been studied using FT-IR spectroscopy and light emission and it has been found to emit in the near infrared region. 4-(Dodecyloxy)benzoic acid also has a mesomorphic phase, which can be seen as a change in its optical properties when heated or cooled. This chemical is hydrophobic with low solubility in water.Purity:Min. 95%Sperm Peptide P10G trifluoroacetate salt
CAS:Please enquire for more information about Sperm Peptide P10G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C36H58N10O13Purity:Min. 95%Molecular weight:838.91 g/molBovine Pineal Antireproductive Tripeptide acetate salt
CAS:Bovine pineal antiprogestin tripeptide acetate salt H-Thr-Ser-Lys-OH acetate salt is a molecule that binds to the prolactin receptor. It is a hydroxyl group reactive, carboxy terminal β amino acid analog of prolactin. It has been shown to have inhibitory properties in cancer cells and can be used as a diagnostic agent for tumor growth. This molecule also inhibits the activity of the prolactin receptor with micrometer-sized particles and has diagnostic potential in breast cancer cells.Formula:C13H26N4O6Purity:Min. 95%Molecular weight:334.37 g/mol(Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about (Phe13,Tyr19)-MCH (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C109H160N30O26S4Purity:Min. 95%Molecular weight:2,434.89 g/molSarafotoxin B trifluoroacetate salt
CAS:Component of snake venom; part of a family of vasoconstrictor isopeptidesFormula:C110H159N27O34S5Purity:Min. 95%Molecular weight:2,563.93 g/molCaloxin 2A1 trifluoroacetate salt
CAS:Please enquire for more information about Caloxin 2A1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C64H91N19O22Purity:Min. 95%Molecular weight:1,478.52 g/molHCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt
CAS:Please enquire for more information about HCV NS4A Protein (21-34) (JT strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C63H116N20O17Purity:Min. 95%Molecular weight:1,425.72 g/molD-Lactic acid benzyl ester
CAS:D-Lactic acid benzyl ester is a chiral molecule that can be used as a feedstock for the production of D-lactic acid. It has been shown to catalyze hydrogenation reactions with an enhanced reaction rate and high selectivity when compared to other methods. The catalytic activity of D-lactic acid benzyl ester can be increased by using zeolites or iron catalyst, which are more expensive than the ligand used in this study. In addition, D-lactic acid benzyl ester was found to be more effective at catalysing the reaction between alkenes and hydrogen gas than other known catalysts. These findings indicate that it may be possible to use D-lactic acid benzyl ester as a cost-effective alternative to other catalysts in industrial processes.Formula:C10H12O3Purity:Min. 95%Molecular weight:180.2 g/molH-Gly-Gly-Arg-anilide acetate salt
CAS:Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H25N7O3Purity:Min. 95%Molecular weight:363.42 g/mol(Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Please enquire for more information about (Cys26)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C194H295N53O57S2Purity:Min. 95%Molecular weight:4,345.87 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/molVIP (4-28) (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about VIP (4-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C134H221N39O36SPurity:Min. 95%Molecular weight:2,986.5 g/molO-Hippuryl-DL-b-phenyllactic acid sodium salt
CAS:Please enquire for more information about O-Hippuryl-DL-b-phenyllactic acid sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C18H16NNaO5Purity:Min. 95%Molecular weight:349.31 g/molOxindole-4-boronic acid, pinacol ester
CAS:Please enquire for more information about Oxindole-4-boronic acid, pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C14H18BNO3Purity:Min. 95%Molecular weight:259.11 g/molO-a-Hippuryl-L-argininic acid hydrochloride salt
CAS:Please enquire for more information about O-a-Hippuryl-L-argininic acid hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C15H20N4O5Purity:Min. 95%Molecular weight:336.34 g/molAdropin (34-76) (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about Adropin (34-76) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C190H293N55O68S2Purity:Min. 95%Molecular weight:4,499.82 g/molDefensin HNP-1 (human) trifluoroacetate salt
CAS:Defensin HNP-1 is a trifluoroacetate salt of human defensin HNP-1. It has antimicrobial activity against Gram-negative and Gram-positive bacteria, including Mycobacterium tuberculosis, Staphylococcus aureus, Mycoplasma pneumoniae, Streptococcus pneumoniae, Haemophilus influenzae and Enterococcus faecalis. The purified protein also has broad-spectrum activity against cancer cells. Defensin HNP-1 is most active in neutrophils from humans with active cystic fibrosis. The protein binds to the bacterial cell membrane and causes the release of lysosomal enzymes that kill the bacteria. Defensin HNP-1 is also able to inhibit the growth of tumor cells as it can be internalized into these cells by endocytosis.Formula:C150H222N44O38S6Purity:Min. 95%Molecular weight:3,442.04 g/molNeuromedin B trifluoroacetate salt
CAS:Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.Formula:C52H73N15O12SPurity:Min. 95%Molecular weight:1,132.3 g/molDABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS trifluoroacetate salt
CAS:Controlled ProductDABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.Formula:C90H120N22O16SPurity:Min. 95%Molecular weight:1,798.12 g/mol3-Methylbenzofuran-2-carboxylic acid
CAS:3-Methylbenzofuran-2-carboxylic acid is a dianion that binds to the cell membrane and inhibits bacterial growth. This compound has been shown to be active against bacteria at low concentrations. 3-Methylbenzofuran-2-carboxylic acid has been used as an antibacterial agent for the treatment of gram-negative bacteria such as Escherichia coli and Proteus mirabilis. It also inhibits the growth of gram-positive bacteria including Staphylococcus aureus, Streptococcus pneumoniae, and Enterococcus faecalis. The reaction temperature required for the synthesis of this compound is high, but it can be prepared at lower temperatures by using anhydrous acetonitrile in place of hydrochloric acid.Formula:C10H8O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:176.17 g/molH-Lys-Gly-Lys-OH acetate salt
CAS:The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.Formula:C14H29N5O4Purity:Min. 95%Molecular weight:331.41 g/molHepcidin-1 (mouse) trifluoroacetate salt
CAS:Please enquire for more information about Hepcidin-1 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C111H169N31O35S8Purity:Min. 95%Molecular weight:2,754.25 g/molOsteostatin (human) trifluoroacetate salt
CAS:Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.Formula:C142H228N42O58Purity:Min. 95%Molecular weight:3,451.58 g/molTos-Gly-Pro-Lys-AMC trifluoroacetate salt
CAS:Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C30H37N5O7SPurity:Min. 95%Molecular weight:611.71 g/molGamma3-MSH trifluoroacetate salt
CAS:Please enquire for more information about Gamma3-MSH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C126H188N44O37SPurity:Min. 95%Molecular weight:2,943.18 g/mol(D-His2)-LHRH trifluoroacetate salt
CAS:Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C55H75N17O13Purity:Min. 95%Molecular weight:1,182.29 g/molACTH (1-14) trifluoroacetate salt
CAS:Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C77H109N21O20SPurity:Min. 95%Molecular weight:1,680.88 g/molTetrabutylammonium acetate
CAS:Tetrabutylammonium acetate is a complex of tetrabutylammonium with the trifluoroacetate anion. It has been used as a reagent for the preparation of α-hydroxylated ketones, including natural products. Tetrabutylammonium acetate can be used in titration calorimetry to measure the heat evolved during the reaction between hydroxyl group and sodium salts. The heat released corresponds to the amount of water produced from this reaction. In this way, it can be determined whether or not a molecule contains an active hydrogen atom. Tetrabutylammonium acetate also reacts with reactive compounds such as dpp-iv inhibitors, forming a reactive intermediate that cannot be isolated due to its instability. This intermediate is detected by analytical methods such as plasma mass spectrometry or infrared spectroscopy. Tetrabutylammonium acetate also reacts with asymmetric synthesis, forming an intramFormula:C16H36N•C2H3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:301.51 g/molPreptin (human) trifluoroacetate salt
CAS:Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C187H275N47O53Purity:Min. 95%Molecular weight:4,029.47 g/molOmega-Agatoxin IVa trifluoroacetate
CAS:Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).
Formula:C217H360N68O60S10Purity:Min. 95%Molecular weight:5,202.26 g/molNeuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt
Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C175H290N56O59Purity:Min. 95%Molecular weight:4,122.52 g/mol(D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C60H100N22O14S3Purity:Min. 95%Molecular weight:1,449.77 g/mol1-Butanesulfonic acid sodium
CAS:1-Butanesulfonic acid sodium salt is a perfluorinated compound that inhibits the activity of various enzymes in the body, such as kinases and phosphatases. It has been used to study the effects of these enzymes on chemical reactions. 1-Butanesulfonic acid sodium salt is also used to detect the presence of selenium compounds in urine samples. The inhibition of an enzyme by this compound results in a decreased rate of reaction and a change in kinetic behavior. This can be observed by measuring the time it takes for the reaction to reach half its maximum value. Sodium taurocholate, chloride, and trifluoroacetic acid are all reagents that are commonly used with this compound when performing kinetic studies. 1-Butanesulfonic acid sodium salt has been shown to inhibit cholesterol synthesis in many animal models. In addition, this compound has been shown to bind to and inhibit plasma mass spectrometry by chromatography on silica gel from human plasmaFormula:C4H10O3S•NaPurity:Min. 95%Color and Shape:PowderMolecular weight:161.18 g/mol(Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt
CAS:Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C64H107N25O19S2Purity:Min. 95%Molecular weight:1,594.82 g/mol(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt
CAS:Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H69N9O11SPurity:Min. 95%Molecular weight:920.13 g/mol(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt
CAS:(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as
Formula:C109H163N25O32SPurity:Min. 95%Molecular weight:2,367.68 g/molPrepro VIP (81-122) (human) trifluoroacetate salt
CAS:Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C202H325N53O64SPurity:Min. 95%Molecular weight:4,552.13 g/mol(Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/molEndotrophin (mouse) trifluoroacetate salt
CAS:A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.Formula:C345H520N92O106S7Purity:Min. 95%Molecular weight:7,876.84 g/molH-His-Leu-His-bNA acetate salt
CAS:Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C28H34N8O3Purity:Min. 95%Molecular weight:530.62 g/molPAR-4 (1-6) (mouse) trifluoroacetate salt
CAS:Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C33H45N7O8Purity:Min. 95%Molecular weight:667.75 g/molNesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt
Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C167H260N40O54Purity:Min. 95%Molecular weight:3,692.09 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS:FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.Formula:C22H38N4O3S2Purity:Min. 95%Molecular weight:470.69 g/molDABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt
CAS:Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C76H98N16O15SPurity:Min. 95%Molecular weight:1,507.76 g/mol3-Fluoro-2-nitrobenzoic acid
CAS:3-Fluoro-2-nitrobenzoic acid is an anhydrous nitrating agent that reacts with 5-fluoro-2-nitrobenzoic acid to produce 3,5-difluoronitrobenzene. This reaction mixture is introduced into a reaction vessel and heated in the presence of sulfuric acid. 3-Fluoro-2-nitrobenzoic acid is used in the production of dyes and pharmaceuticals.Formula:C7H4FNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:185.11 g/molOrphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt
CAS:Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C126H195N37O37Purity:Min. 95%Molecular weight:2,820.12 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C23H31N5O6Purity:Min. 95%Molecular weight:473.52 g/mol3,4,5-Trichlorobenzoic acid
CAS:Trichlorobenzoic acid is a chemical compound that is found in plants, such as Trifolium pratense L. and other legumes. It has been shown to inhibit the growth of bacteria by competitive inhibition of the enzyme ribonucleotide reductase, which catalyzes the conversion of ribonucleotides to deoxyribonucleotides. This prevents the production of RNA, which is necessary for protein synthesis and cell division. Inhibition of this enzyme can be achieved by either conjugating trichlorobenzoic acid with a sugar or using ion-exchange resins to remove it from water. The concentration required for this type of inhibition varies depending on the type of organism, but generally ranges between 5-10 ppm.END>
Purity:Min. 95%Leptin (116-130) amide (mouse) trifluoroacetate salt
CAS:Amide; Trifluoroacetate saltFormula:C64H109N19O24SPurity:Min. 95%Molecular weight:1,560.73 g/mol1H-Pyrrole-2,5-dicarboxylic acid
CAS:1H-Pyrrole-2,5-dicarboxylic acid is a biosynthetic precursor of the amide functional group. It is synthesized from the carboxylic acid functional group and ferrocene. It has been shown to be a putative precursor of pyrrole-2-carboxylic acid in the pyrrole system. 1H-Pyrrole-2,5-dicarboxylic acid reacts with carbon tetrachloride and diethyl iminodiacetate in refluxing chloroform to produce coelicolor. The reaction mechanism for this transformation is unknown, but it is hypothesized that it involves a radical mechanism.Formula:C6H5NO4Purity:Min. 95%Molecular weight:155.11 g/mol(Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt
CAS:Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C107H162N30O30Purity:Min. 95%Molecular weight:2,348.62 g/molAcetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt
CAS:Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C135H207N39O30SPurity:Min. 95%Molecular weight:2,888.4 g/mol(Sar 1,Val5,Ala8)-Angiotensin II trifluoroacetate salt
CAS:Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.Formula:C42H65N13O10•C2HF3O2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,026.07 g/molHTLV-1 Tax (11-19) trifluoroacetate salt
CAS:Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C56H79N9O12Purity:Min. 95%Molecular weight:1,070.28 g/molAlloferon - in acetate salt
CAS:Alloferon is a drug that affects the body's biological processes and has been shown to have anticancer and antimicrobial properties. Alloferon binds to histidine residues on peptidoglycan, inhibiting bacterial cell wall synthesis and the development of resistance to antibiotics. It also interacts with amide groups in proteins, which are essential for their biological activity. In addition, Alloferon binds to peptides in the form of an amide bond. This interaction makes Alloferon a bioinorganic molecule that can be used as an antimicrobial agent against microbial infections.
Formula:C52H75N22O16Purity:Min. 95%Molecular weight:1,264.29 g/mol4-Chloro-Nicotinic acid ethyl ester hydrochloride
CAS:4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.
Formula:C8H8ClNO2·HClPurity:Min. 95%Molecular weight:222.07 g/molLactoferricin B (4-14) (bovine) trifluoroacetate salt
CAS:Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.Formula:C70H113N25O13SPurity:Min. 95%Molecular weight:1,544.87 g/molH-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt
CAS:Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C159H267N49O43Purity:Min. 95%Molecular weight:3,553.13 g/molUrocortin II (mouse) trifluoroacetate salt
CAS:Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C187H320N56O50Purity:Min. 95%Molecular weight:4,152.89 g/mol4-Bromobutyl acetate
CAS:4-Bromobutyl acetate is a nucleic acid that contains a hydroxyl group, two nitrogen atoms, and four carbon atoms. It is the acetic ester of 4-bromobutyric acid. 4-Bromobutyl acetate can be found in the nucleus of cells and in mitochondria. It has been shown to bind to p2y receptors on the surface of cells and is thought to have tuberculostatic activity in vitro. 4-Bromobutyl acetate has also been shown to inhibit viral replication by binding to template or molecule. This nucleic acid can be used as a sequencing template because it will form complementary base pairs with other molecules that contain complementary sequences of nucleic acids.Formula:C6H11BrO2Purity:Min. 95%Molecular weight:195.05 g/molDansyl-Ala-Arg-OH trifluoroacetate salt
CAS:Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H30N6O5SPurity:Min. 95%Molecular weight:478.57 g/molOsteocalcin (1-49) (human) acetate salt
CAS:Osteocalcin is a protein that is synthesized by osteoblasts and released into the extracellular matrix. It is involved in the regulation of bone metabolism, including the synthesis and mineralization of bone matrix. Osteocalcin has been shown to be a marker for osteoarthritis, which may be due to its role in cartilage degradation. This protein has also been implicated in prognosis and diagnosis of this condition. Osteocalcin can be used as a marker for monitoring disease-modifying therapies such as chondroitin sulfate or cross-linking agents.Formula:C269H381N67O82S2Purity:Min. 95%Molecular weight:5,929.44 g/molBiotinyl-Obestatin (rat) trifluoroacetate salt
CAS:Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C124H188N36O33SPurity:Min. 95%Molecular weight:2,743.11 g/mol3-Cyanopropanoic acid
CAS:3-Cyanopropanoic acid is a reactive compound that forms a complex with palladium. It is produced by the reaction of acrylonitrile and chloride in the presence of a base such as sodium hydroxide. The reaction mechanism is shown below:Formula:C4H5NO2Purity:Min. 95%Color and Shape:PowderMolecular weight:99.09 g/molFurin Inhibitor II trifluoroacetate salt
CAS:Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.Formula:C36H75N25O6Purity:Min. 95%Molecular weight:954.15 g/molCys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt
CAS:Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C112H176N38O22S3Purity:Min. 95%Molecular weight:2,503.04 g/molN-Boc-isonipecotic acid
CAS:N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.Formula:C11H19NO4Purity:Min. 95%Molecular weight:229.27 g/molC3a (70-77)
CAS:C3a is a molecule that is part of the complement system. It was first discovered in leukocytes and has since been detected in other populations. C3a is a chemotactic factor for neutrophils and eosinophils, which are types of white blood cells. C3a binds to the surface of cells by means of protein-antibody interactions, and it can also act as an anaphylatoxin by binding to mast cell receptors.
Formula:C35H61N13O10Purity:Min. 95%Molecular weight:823.94 g/mol(1S,2R)-Fmoc-aminocyclohexane carboxylic acid
CAS:Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C22H23NO4Purity:Min. 95%Molecular weight:365.42 g/molGalnon trifluoroacetate salt
CAS:Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.
Formula:C40H46N4O6Purity:Min. 95%Molecular weight:678.82 g/mol(D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt
CAS:Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.Formula:C60H87N19O13Purity:Min. 95%Molecular weight:1,282.45 g/molNeuronostatin-19 (human, canine, porcine) trifluoroacetate salt
Please enquire for more information about Neuronostatin-19 (human, canine, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C90H151N29O25Purity:Min. 95%Molecular weight:2,039.34 g/molKisspeptin-54 (27-54) (human) trifluoroacetate salt
CAS:Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C149H226N42O39Purity:Min. 95%Molecular weight:3,229.65 g/molTGF alpha (1-50) (rat) trifluoroacetate salt
CAS:Please enquire for more information about TGF alpha (1-50) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C244H361N71O71S6Purity:Min. 95%Molecular weight:5,617.31 g/molUrocortin (human) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C204H337N63O64Purity:Min. 95%Molecular weight:4,696.24 g/molAmyloid P Component (33-38) amide trifluoroacetate salt
CAS:Please enquire for more information about Amyloid P Component (33-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C37H56N10O7SPurity:Min. 95%Molecular weight:784.97 g/molGRF (bovine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C220H366N72O66SPurity:Min. 95%Molecular weight:5,107.77 g/molN-[3-Fluoro-4-[6-(2-methyl-2H-tetrazol-5-yl)-3-pyridinyl]phenyl]carbamic acid phenylmethyl ester
CAS:Intermediate in the synthesis of tedizolidFormula:C21H17FN6O2Purity:Min. 95%Molecular weight:404.4 g/mol(D-Trp6,D-Leu7)-LHRH trifluoroacetate salt
CAS:Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C64H82N18O13Purity:Min. 95%Molecular weight:1,311.45 g/molPreangiotensinogen (11-14) (human) acetate salt
CAS:Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H35N7O6Purity:Min. 95%Molecular weight:481.55 g/molβ-MSH (human) trifluoroacetate salt
CAS:Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.Formula:C118H174N34O35SPurity:Min. 95%Molecular weight:2,660.92 g/molN-Acetoacetylcresidine sulfonic acid sodiumsalt
CAS:Please enquire for more information about N-Acetoacetylcresidine sulfonic acid sodiumsalt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H14NNaO6SPurity:Min. 95%Molecular weight:323.3 g/molH-Ala-His-Ala-OH acetate salt
CAS:Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C12H19N5O4Purity:Min. 95%Molecular weight:297.31 g/molHepcidin-24 (human) trifluoroacetate salt
Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C109H165N33O28S9Purity:Min. 95%Molecular weight:2,674.28 g/mol3-Phenyl-1-adamantane carboxylic acid
CAS:3-Phenyl-1-adamantane carboxylic acid is a thioester that can be used in the synthesis of anti-fungal and antiviral agents. 3-Phenyl-1-adamantane carboxylic acid has been shown to have anti-viral activity against herpes simplex virus type 1 (HSV-1) and type 2 (HSV-2). It also has anthelmintic properties, which may be due to its ability to inhibit the growth of parasitic worms. 3PCA can also be used in the synthesis of cyclic anthelmintics, which are drugs that treat worm infestations.Formula:C17H20O2Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:256.34 g/molAmyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (586-595) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C47H73N11O16SPurity:Min. 95%Molecular weight:1,080.21 g/molLQEQ-19 (human) trifluoroacetate salt
Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C106H170N30O34Purity:Min. 95%Molecular weight:2,408.67 g/molNeuropeptide Y (13-36) (human, rat) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C134H207N41O36SPurity:Min. 95%Molecular weight:3,000.4 g/moltert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate
CAS:Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C13H24N2O3Purity:Min. 95%Molecular weight:256.34 g/molGalanin Message Associated Peptide (1-41) amide trifluoroacetate salt
CAS:Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C206H326N56O64SPurity:Min. 95%Molecular weight:4,643.2 g/mol(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS:Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C149H226N40O46Purity:Min. 95%Molecular weight:3,313.63 g/molFmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh)
Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Z-Val-Lys-Met-AMC acetate salt
CAS:Bortezomib is a proteasome inhibitor that binds to the catalytic site of the proteasome and inhibits its activity. Bortezomib is used as an anticancer agent to treat multiple myeloma, T-cell lymphomas, and other cancers. It has been shown to inhibit the growth of cancer cells and slow tumor progression in animal models. The drug has also been shown to decrease insulin resistance in mice with high blood sugar levels by inhibiting histone deacetylase (HDAC). This inhibition leads to increased expression of genes that are involved in glucose metabolism and decreased expression of genes that regulate fat production.
The drug also binds tightly to the insulin receptor, which may lead to improved glucose uptake into cells.Formula:C34H45N5O7SPurity:Min. 95%Molecular weight:667.82 g/molLinolenic acid - 98%
CAS:Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.Formula:C18H30O2Purity:Min. 95%Color and Shape:PowderMolecular weight:278.43 g/molEthyl 2-(chlorosulfonyl)acetate
CAS:Ethyl 2-(chlorosulfonyl)acetate is a drug candidate that inhibits the enzyme cholesterol acyltransferase (ACAT), which is responsible for the formation of cholesterol esters. It has been shown to be effective in animal models for the treatment of metabolic disorders, such as hypercholesterolemia and hypertriglyceridemia. In addition, it has been shown to inhibit the activity of serine proteases, which are involved in coagulation, amido hydrolase, and nucleophilic attack reactions. Ethyl 2-(chlorosulfonyl)acetate has also been shown to activate gene product in cellular studies with mouse fibroblasts.Purity:Min. 95%Color and Shape:PowderMolecular weight:186.61 g/mol1,1-Cyclohexanediacetic acid anhydride
CAS:1,1-Cyclohexanediacetic acid anhydride is a synthetic polymer that is soluble in water. It is used in wastewater treatment to remove organic contaminants. 1,1-Cyclohexanediacetic acid anhydride reacts with gabapentin to form amide and monoamide derivatives. This reaction is catalyzed by acylation agents such as hydrochloric acid and organic solvents such as benzene. The resulting products are virulent, allowing them to be used in the treatment of epilepsy.
Formula:C10H14O3Purity:Min. 95%Molecular weight:182.22 g/mol
