Carboxylic Acids

<p>Rhodanine-N-acetic acid is a model system for antimicrobial agents. It is an acidic molecule with low light absorption and can be used as a chemotherapeutic agent. Rhodanine-N-acetic acid has been shown to have high resistance to bacteria in vitro, making it effective against malonic acid, which is the main cause of infection. Rhodanine-N-acetic acid has been shown to have biological properties, such as photophysical and redox potentials that make it suitable for use in vivo. Rhodanine-N-acetic acid also has photocurrent and electrochemical impedance spectroscopy characteristics that may be used to measure its activity in vivo.</p>

<p>H-Arg-Arg-OH acetate salt is a protease inhibitor. It has been shown to inhibit the activity of serine proteases, such as trypsin and chymotrypsin, in vitro. H-Arg-Arg-OH acetate salt binds to the active site of the enzyme and prevents substrate binding. The acidity of the environment where this inhibitor is active can be used to control its activity. At acidic pH, H-Arg-Arg-OH acetate salt is more potent than at neutral pH. When it comes into contact with a protein substrate, H-Arg-Arg-OH acetate salt will bind to a hydroxyl group on the protein molecule and prevent it from hydrolyzing its substrate. This process can be reversed by adding an alkaline buffer to increase the pH of the system or by adding an acid buffer to decrease it.br&gt;br&gt; H-Arg-Arg-OH acetate salt is found in cyanob</p>

<p>Please enquire for more information about Abz-Ala-Phe-Ala-Phe-Asp-Val-Phe-3-nitro-Tyr-Asp-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ethyl 4-amino-2-mercaptopyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (3-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gliadorphin is a peptide that occurs in cow's milk. It has been shown to be effective against bacterial translocation, which is the passage of bacteria from the gut into other parts of the body. Gliadorphin also has a safety profile, with no observed adverse effects in animal studies and dietary trials. The biological samples used for this study were casein and urine samples. The antibodies used were polyclonal antibodies and Gliadorphin was tested for its ability to bind to bacterial proteins in vivo. Hydration may be necessary for optimal absorption of gliadorphin, as dehydration can affect immune reaction. Gliadorphin does not have any known side effects or drug interactions, but it should not be used by people with an allergy to casein or those who are allergic to mammalian serine proteases (such as trypsin).</p>

<p>Please enquire for more information about Anantin (linear sequence) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-His2,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Met-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt is a photoelectron that binds to the integrin receptor. It has been shown that H-Gly-Arg-Gly-Asp-Ser-Cys-OH trifluoroacetate salt can inhibit protein synthesis in mesenchymal stromal cells. H Gly Arg Gly Asp Ser Cys OH trifluoroacetate salt can also be used as a reagent to determine the presence of amide bonds and to identify proteins. This compound may have biotechnological applications due to its biochemical properties.</p>

<p>The H-Tyr-Ile-Gly-Ser-Arg-OH trifluoroacetate salt is a synthetic peptide that has been shown to promote neuronal growth and axonal regeneration. This compound has been synthesized using a biocompatible polymer, collagen gel, and neurotrophic factors. The peptide is also able to stimulate the synthesis of collagen in mesenchymal cells cultured in tissue culture. The peptide can be used for treatment of subcutaneous tumors and neural injury.</p>

<p>Please enquire for more information about Mca-(endo-1a-Dap (Dnp))-TNF-a (-5 to +6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>tert-Butyl acetate is an organic compound that is used in the synthesis of pharmaceuticals. It is a colorless liquid that can be evaporated to produce a white solid. It has a strong odor and is soluble in water, acetone, and most other organic solvents. Tert-butyl acetate can also be used as a solvent for coatings and adhesives, or as an additive to fuels.</p>

<p>GAP 27 is a connexin that is expressed in the cardiac and skin cells. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile-OH acetate salt is made up of a number of amino acids, including serine, arginine, proline, glutamic acid, lysine, threonine and isoleucine. It has been shown to have biological function in vivo models and in vitro assays. GAP 27 acetate salt H-Ser-Arg-Pro-Thr-Glu-Lys-Thr--Ile--Phe--Ile--Ile--OH acetate salt has been shown to be non toxic to the heart and skin cells. This protein also shows growth factor activity when it interacts with toll like receptor 4 (TLR4) on human skin cells.</p>

<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp8)-Somatostatin-14 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about H-Pro-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Parathyroid hormone-related protein (PTHrP) is a peptide hormone produced by the parathyroid gland that functions as a phosphatase, inhibiting alkaline phosphatase. It also has an inhibitory effect on osteoclastic bone resorption and stimulates osteoblastic bone formation. PTHrP has been shown to be useful in treating osteoporosis and Paget's disease. It also has been used in conjunction with dexamethasone to treat patients with malignancies of the head and neck. PTHrP is an inhibitor of protein kinase A and phosphodiesterases, which are enzymes that regulate cellular processes such as proliferation and differentiation.</p>

<p>Fmoc-L-aspartic acid b-methylpentyl ester is a solid phase synthesis of Asp(OtBu)-OH that has been synthesized by reacting aspartic acid with piperidine and methylbenzene. This synthesis has been shown to be effective at temperatures below 25°C, to minimize the formation of water, and to be resistant to treatments with strong acids or bases. The synthesis has also been optimized for the peptidyl bond formation and peptide synthesis, resulting in enhanced yields.</p>

<p>Cefepime is a broad-spectrum antibiotic that is used to treat bacterial infections. It inhibits cell wall synthesis by binding to the penicillin-binding proteins and interfering with the cross-linking of peptidoglycan. Cefepime has been shown to be active against gram-negative pathogens such as Aeruginosa, Stenotrophomonas maltophilia, and P. aeruginosa. Cefepime also inhibits the growth of gram-positive bacteria such as Staphylococcus aureus, Enterococcus faecalis, and Streptococcus pneumoniae. The chemical structure of cefepime is similar to that of other beta-lactam antibiotics like methicillin, oxacillin, cloxacillin, ampicillin, and amoxicillin. Cefepime has been shown to be effective in treating resistant gram-negative organisms such as Pseudomonas aeruginosa (P.</p>

<p>2-Mercaptonicotinic acid (2MNA) is an inhibitor of the P-glycoprotein, which is a multidrug resistance-associated protein. It prevents the transport of drugs and other molecules across the cell membrane. 2MNA has been shown to inhibit cancer cells in cervical cancer studies, and has been proven to reduce the toxicity of chemotherapy drugs in rats. 2MNA binds to p-glycoprotein and inhibits its function by forming a disulfide bond with cysteine residues on the transporter. 2MNA also has toxic effects on human serum and may be hazardous for use as a therapeutic agent.</p>

<p>Please enquire for more information about ACTH (3-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Des-Gly10,D-His(Bzl)6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-His(Bzl)-Leu-Arg-Pro-NHEt acetate salt is a long acting analog of LHRH. It is a biocompatible polymeric drug that has been shown to have long term efficacy in treating various autoimmune diseases and infections. The drug's efficacy may be due to its ability to bind to the specific receptors on the surface of cells that are involved in the immune response. DesGly10,D-His(Bzl)6,ProNHEt9)-LHRH acetate salt Pyr His Trp Ser Tyr D His(Bzl)-Leu Arg Pro NHEt acetate salt is an analog of LHRH and has been shown to be effective in treating cancer and allergic symptoms as well.</p>

<p>Secretin acetate salt H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala is a peptide that is secreted by the pancreas in response to the ingestion of food. Secretin stimulates the release of water and bicarbonate from the pancreas, as well as stimulating the gallbladder to contract, which results in increased flow of bile. Secretin also inhibits gastric acid secretion, slows intestinal motility, and stimulates pancreatic enzyme secretion. The amino acid sequence of this peptide is identical to that of leuprolide acetate (Lupron) and goserelin acetate (Zoladex), which are synthetic analogs with similar biological activity. This peptide can be synthesized on a solid phase or in solution phase. Solid phase synthesis involves attaching amino acids</p>

<p>2-[4-(Diethylamino)-2-hydroxybenzoyl]benzoic acid hexyl ester is a sunscreen agent that has been shown to be effective against the formation of skin cancer. This compound is a white powder that can be used as a cream or lotion and is typically applied to the skin before going out in the sun. 2-[4-(Diethylamino)-2-hydroxybenzoyl]benzoic acid hexyl ester absorbs ultraviolet radiation, preventing it from penetrating the skin and causing damage. The compound also acts as an antioxidant, protecting cells from oxidative stress.</p>

<p>4-Amino-5-methoxy-2-methylbenzenesulfonic acid is a compound that has been used as an additive to analytical reagents in order to improve their sensitivity. This compound is used as the sodium salt, which is water soluble and has a high degree of reproducibility. 4-Amino-5-methoxy-2-methylbenzenesulfonic acid has also been used for the validation of analytical methods, including calibration and cytotoxicity testing. The validation procedure includes colorants, spectra analysis, impurities, and solvents.</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,Igl5,D-Igl7, Oic 8)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate is a molecule that has been used in the diagnosis of cervical cancer. This drug binds to the metal chelator and is then attached to a water molecule by the functional group. This process makes the compound more stable and prevents it from reacting with other molecules. The cyclic peptide is then attached to the tri-tert-butyl 1,4,7,10-Tetraazacyclododecane-1,4,7-triacetate molecule which can be detected by an MRI scan.</p>

<p>Chlorotoxin trifluoroacetate salt is a chlorotoxin derivative that has been modified to be more soluble in aqueous solutions. It is used to identify skin cancer and other forms of cancer, as well as for the study of cellular function and structure. The molecule can be injected into tissue or cells, where it binds to nuclei and causes cell death. Chlorotoxin trifluoroacetate salt has minimal toxicity in humans and can be used on histological specimens with little disruption to the tissue. This reagent may also be used to target intracellular targets such as glioma cells.</p>

<p>Epsilon-Maleimidocaproic acid-(2-nitro-4-sulfo)-phenyl ester·sodium salt (EMAP) is a crosslinker that belongs to the group of heterobifunctional reagents. It has been used to conjugate monoclonal antibodies with other molecules, such as toxins. EMAP is activated by the dianion generated by protonation of the nitro groups on the phenyl ring and reacts with free amines or thiols in proteins. EMAP can be used for labeling immunotoxins for diagnostic use, maximizing detection sensitivity, and crosslinking DNA molecules for use in molecular cloning experiments.</p>

<p>Please enquire for more information about CRAMP (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Alpha-Helical CRF (9-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid is a diazirine that is used to form copper complexes. These complexes are then used as diagnostic agents for the detection of nucleic acids in biological samples, such as wheat germ and human tissue. 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid may also be used in the production of polymer films. It has been shown to have a dihedral angle (C), which is an important factor in the properties of surfactants. The properties of 4-(3-(Trifluoromethyl)-3H-diazirin-3-yl)benzoic acid depend on its functional groups, fatty acids, and dimethylformamide content.</p>

<p>Pancreastatin (33-48) is a synthetic, acidic, sulfated peptide that has been shown to have high activity against pancreatic cancer cells. Pancreastatin (33-48) has been synthesized by reacting an oligopeptide with glutamic acid and aspartic acid. The N-terminal of this peptide is amidated and contains a sulfate group. This molecule has been purified by SDS-polyacrylamide gel electrophoresis and the sulfate fractionation method. Pancreastatin (33-48) is able to inhibit the proliferation of pancreatic tumor cells in vitro, but it does not appear to be cytotoxic to normal pancreatic cells. In addition, pancreastatin (33-48) has also been shown to decrease tumor growth in vivo in mice bearing a transplanted human pancreatic tumor.</p>

<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>

<p>Agonist of toll-like receptors TLR1/2</p>

<p>7-Amino-3-vinyl-3-cephem-4-carboxylic acid (AVC) is a synthetic, inorganic acid that is used clinically. It is produced by the hydrolysis of chlorocarboxylic acids and has been shown to be effective as an antihypertensive agent. AVC has also been used as a catalyst for acylation reactions with chlorides and trifluoroacetic acid. This process yields a reaction yield that can be up to 95% with the use of catalysts such as aluminum chloride or zinc chloride. AVC has been shown to be an environmentally safe alternative to hydrogen chloride, which has been linked to environmental pollution.</p>

<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>

<p>Please enquire for more information about Neuropeptide Y (22-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>D,L-Benzylsuccinic acid is an oral hypoglycemic agent that belongs to the group of antidiabetic agents. It is a crystalline cellulose-based drug with a hypoglycemic effect. D,L-Benzylsuccinic acid has been shown to be effective in the treatment of autoimmune diseases, such as diabetes mellitus and rheumatoid arthritis. The mechanism of action of this drug is not yet fully understood.</p>

<p>Please enquire for more information about Z-Arg-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about tert-Butyl2-bromo-6,7-dihydrothiazolo[5,4-c]pyridine-5(4H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.</p>

<p>Ethyl diphenylacetate is a trifluoromethyl group that has the potential for use as a fungicide. The hydrochloride salt of this compound exhibits high activity against various fungi, such as Rhizoctonia solani, Sclerotium rolfsii, and Botrytis cinerea. Ethyl diphenylacetate has also been shown to be an effective herbicide in plants, as it inhibits the enzyme acetolactate synthase and prevents the formation of branched-chain amino acids. It can also inhibit germination of seeds.</p>

<p>Neuropeptide AF is a peptide that is synthesized in the brain and has been shown to have a wide range of biological activities. It has been shown to block growth factor-β1, activate the ryanodine receptor, and cause neuronal death. Neuropeptide AF also activates the polymerase chain reaction (PCR) and can be used as a potential biomarker for Alzheimer's disease. Neuropeptide AF has been shown to decrease body mass index and improve long-term efficacy in patients with chronic heart disease. There is also evidence that Neuropeptide AF binds calcium ions, which may play a role in structural heart disease or cardiac function.</p>

<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>

<p>Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide S (1-10) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Methyl 4-tert-butylphenylacetate is a chemical compound that has been used in various research collaborations. It is also used as a solvent for the production of octanoic acid and isobutyric acid, which are important chemical compounds for use in the food industry. The utilisation of methyl 4-tert-butylphenylacetate has been studied by researchers in relation to its maltol, levulinate and hexanoic acid derivatives. This compound can be used as a replacement for other chemicals such as sulfate, butanedione and propylene glycol in industrial applications.</p>

<p>Please enquire for more information about (Gly21)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Thrombin Receptor Antagonist trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Eledoisin acetate salt is a cell-lysing agent that belongs to the group of potent antagonists. It is an inhibitor of neurokinin-1 receptor which regulates the release of substance P and other inflammatory mediators from nerve terminals. Eledoisin acetate salt has shown to inhibit locomotor activity in rats, as well as nucleotide levels in cells. This drug also has been shown to have carcinoid syndrome-like effects, such as weight loss and diarrhea. These symptoms are caused by the inhibition of substance P at its receptors. The tumor necrosis factor (TNF) may be responsible for these effects, since it causes increased production of substance P in cells.</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>

<p>Please enquire for more information about 4-[(4-chlorophenyl)-2-pyridinylmethoxy]-1-piperidinecarboxylic acid ethylester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Trp-Glu-His-Asp-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Cyclohexyl-2-hydroxy-phenylacetic acid is a potent inhibitor of the cholinergic muscarinic receptors. It has been used as an anticholinergic drug and in pharmaceutical preparations for the treatment of inflammatory diseases. 2-Cyclohexyl-2-hydroxy-phenylacetic acid is used to treat urinary incontinence, although it can also cause constipation. Side effects of 2-cyclohexyl-2-hydroxy phenylacetic acid include headache, drowsiness, dry mouth, and blurred vision. 2 CPHPA is an inorganic acid that reacts with phosphorus pentachloride to form an organic phosphate ester called pentachlorophosphoric acid (PCPA). This reaction can be reversed by adding hydrochloric acid. The PCPA salt of 2 CPHPA is called diethylamine salt.</p>

<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>

<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Glu-Lys-Leu-Ile-Val-Val-Ala-Phe-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Pro-Lys-OH acetate salt is a synthetic compound that is specific for histidine residues. It catalyzes the hydrolysis of fibrinogen to form fibrin, which can be used in the formation of blood clots. This molecule has been shown to have a number of sequences and acid analysis. H-Pro-Lys-OH acetate salt can be used as an additive in food products. The incubation process should be done at pH 4.5 and the reaction should be stopped by adding tripeptides followed by using ion-exchange chromatography or SDS polyacrylamide gel electrophoresis to analyze the amino acids present in the product.</p>

<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>

<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>

<p>2-Methoxy-6-picolinic acid (2MPA) is a picolinate that has been shown to be an effective catalyst for the conversion of alcohols into allylic alcohols. 2MPA is able to catalyze the reaction by abstracting hydrogen from the carbonyl group, and then adding it to the adjacent carbon. This reaction can produce peroxide as a byproduct, which is subsequently hydrolyzed to form water and alcohol. The β-unsaturated carbonyl group of 2MPA provides additional stability for this catalytic process.<br>2MPA can also be used as a catalyst in other reactions, such as the oxidation of benzylic alcohols with hydrogen peroxide to form benzylic carbonyl compounds.</p>

<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5,6-Dichloronicotinic acid is a compound that can be synthesized by reacting methyl ketones with chloroacetic acid. It is used in the synthesis of maleic anhydride and has been shown to inhibit the catalysis of acetylcholine chloride. 5,6-Dichloronicotinic acid has also been shown to have an inhibitory effect on Alzheimer's disease. The kinetic mechanism for this inhibition occurs through the hydrolysis step of 5,6-Dichloronicotinic acid by magnesium chloride in hexane solution. The reactive acylation reaction proceeds when 5,6-Dichloronicotinic acid reacts with acetic anhydride in the presence of pyridine.</p>

<p>4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid is an organic compound. It is a white solid that is insoluble in water but soluble in organic solvents. The molecule has a molecular weight of 224.8 g/mol and contains a carbonyl group and amine functional groups. 4-[(4-Methylpiperazin-1-yl)methyl]benzoic acid can be prepared by the acylation of 4-(aminomethyl)-benzoic acid with imidazole hydrochloride in the presence of sodium carbonate as a base.</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-(4-Chlorophenyl-acetyl)benzoic acid is a fine chemical that is a versatile building block and useful intermediate. 2-(4-Chlorophenyl-acetyl)benzoic acid is used in the manufacture of other chemicals, such as pharmaceuticals, pesticides, dyes, or perfumes. It is also used for research purposes and as a reagent. It has a CAS number of 53242-76-5.</p>

<p>5-Acenaphthenecarboxylic acid is a xylene derivative that has been characterized as an organometallic compound. The cyclopentane ring is the central feature of this molecule and it can be used in the synthesis of other organic compounds. 5-Acenaphthenecarboxylic acid is toxic to humans and animals and has been shown to induce liver tumors in rats. It also has been shown to inhibit the growth of some bacteria, including Mycobacterium tuberculosis, which causes tuberculosis. 5-Acenaphthenecarboxylic acid inhibits protein synthesis by binding to ribosomes and interfering with the biosynthesis of proteins. This binding prevents formation of a complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Please enquire for more information about Ac-Glu-Asp(EDANS)-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Gly-Lys(DABCYL)-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>

<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>

<p>Linolenic acid is a polyunsaturated fatty acid that is essential for human health. It is a precursor of prostaglandin E2 (PGE2), which has been implicated in the regulation of cell death and inflammation. Linolenic acid has been shown to induce apoptosis in vitro by inhibiting the mitochondrial membrane potential and activating caspases 3 and 9, thereby inducing neuronal death. In vivo, linolenic acid has been shown to have beneficial effects on cardiovascular function, including lowering cholesterol levels and improving blood flow to the heart. Linolenic acid also has antioxidant properties, which may be due to its ability to inhibit lipid peroxidation and scavenge free radicals.</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Galanin Message Associated Peptide (1-41) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about LQEQ-19 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>