Carboxylic Acids

<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>

<p>Please enquire for more information about 2,3,6-Trifluorophenylacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-3 (22-41) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3,5-Diiodo-Tyr1,D-Ala2,N-Me-Phe4,glycinol5)-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (33-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>

<p>Neuropeptide Y (porcine) trifluoroacetate salt H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu -Ala -Arg Tyr Tyr Ser Ala Leu Arg His Tyr Ile Asn Leu Ile Thr Arg Gln Arg Tyr NH2 trifluoroacetate salt is a peroxidase enzyme that is biotinylated and purified from porcine sources. It has been used as an antiserum in the development of a plate sealer.</p>

<p>Z-L-alpha-aminobutyric acid is a homogeneous, optically active, linear phosphinic analogue of alpha-aminobutyric acid. It has been used in the synthesis of phosphinic analogues of cyclosporin and undecapeptides with high yields. The coupling reaction between Z-L-alpha-aminobutyric acid and benzaldehyde was carried out in two steps to produce the desired product. A stepwise condensation between Z-L-alpha-aminobutyric acid and 3,4,5,6 tetrahydropyrimidine was also successful.</p>

<p>(±)7-EpiJasmonic acid is a carotenoid ester that has been found to have biological properties for weed control. It is the methyl ester of jasmonic acid, which is a fatty acid. The compound has been shown to be effective in suppressing plant diseases such as powdery mildew. The chemical transformation of (±)7-epiJasmonic acid can occur through methylation, hydroxylation, or nitro group formation. This process leads to the production of methyl jasmonate and nitrophenol. These compounds have been shown to have fertility effects on lettuce plants by increasing the number of seeds and seedlings produced.</p>

<p>2,6-Dichloro-5-fluoronicotinic acid (2,6-DCFNA) is a chlorinating agent that is activated in acidic solutions. It is used to produce the disinfectant peracetic acid and in the industrial process of producing phenol. 2,6-DCFNA reacts with chloride to form hypochlorous acid (HOCl), which causes inflammation in cells by activating inflammatory cells such as neutrophils and macrophages. 2,6-DCFNA also inhibits tyrosine kinase activity, which may contribute to its anti-inflammatory properties. The toxic effects of 2,6-DCFNA have been studied on hematopoietic cells in vitro. Studies show that this compound can cause apoptosis or death of these cells and may be useful for the treatment of inflammatory diseases such as rheumatoid arthritis. 2,6-DCFNA has also been shown to inhibit tumor growth when</p>

<p>4-Aminopicolinic acid is a synthetic amine that has been shown to activate plant science. 4-Aminopicolinic acid is a cyclic peptide with two subunits, one of which is 4-amino-3-pyridinecarboxylic acid. This compound has been synthesized from picolinic acid, an agriculturally important compound that is found in plant and animal tissues. The synthesis of 4-aminopicolinic acid involves the reaction of picolinic acid with nitrous oxide, followed by hydrolysis and oxidation to form the desired product. Hplc analyses have confirmed the presence of picolinic acid in extracts from various plants containing this compound.</p>

<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>

<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methoxyphenylboronic acid is a photophysical molecule that can be used as an analytical reagent in plant physiology and analytical chemistry. 3-Methoxyphenylboronic acid reacts reversibly with copper ions to form a complex. The binding constants of the copper complex depend on the pH of the solution, which can be altered by adding a phosphate derivative to the solution. This reaction was investigated using cross-coupling techniques and showed that the binding constants for this complex are dependent on the type of solvent used. 3-Methoxyphenylboronic acid has also been used to measure glucose levels in blood samples.</p>

<p>Eledoisin acetate salt is a cell-lysing agent that belongs to the group of potent antagonists. It is an inhibitor of neurokinin-1 receptor which regulates the release of substance P and other inflammatory mediators from nerve terminals. Eledoisin acetate salt has shown to inhibit locomotor activity in rats, as well as nucleotide levels in cells. This drug also has been shown to have carcinoid syndrome-like effects, such as weight loss and diarrhea. These symptoms are caused by the inhibition of substance P at its receptors. The tumor necrosis factor (TNF) may be responsible for these effects, since it causes increased production of substance P in cells.</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>

<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>

<p>Please enquire for more information about Amyloid Bri Protein (1-23) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt is a peptide that has been shown to inhibit the growth of tumor cells. It has also been shown to have biological properties in a number of experimental models, including in vitro and in vivo studies. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH trifluoroacetate salt inhibits muscle cell proliferation by binding to the extracellular matrix protein collagen type I. This inhibition leads to reduced tissue formation and body growth. This peptide also inhibits the proliferation of cancer cells by blocking the production of growth factor beta 1 (GFβ1).</p>

<p>Conjugated linoleic acid (CLA) is a fatty acid found in beef and dairy products. It is a conjugated form of linoleic acid, which means it has two or more double bonds in its chemical structure. CLA may help to regulate energy metabolism by inhibiting the activity of enzymes involved in fat and carbohydrate metabolism. CLA has also been shown to have inhibitory properties against polymerase chain reaction (PCR), an enzyme that copies DNA during cell division. CLA has also been shown to reduce the symptoms of bowel disease, including reducing inflammation and improving insulin sensitivity. CLA may suppress body weight gain and fat accumulation in humans, as well as reduce the development of type 2 diabetes mellitus. In addition, CLA may be effective against infectious diseases such as tuberculosis and HIV/AIDS because it can lower levels of pro-inflammatory cytokines like tumor necrosis factor-α (TNF-α)</p>

<p>Please enquire for more information about tert-Butyl 7-bromo-3,4-dihydroisoquinoline-2(1H)-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Copeptin (rat) trifluoroacetate salt is a peptide that belongs to the group of protein inhibitors. It can inhibit the activity of the acetylcholine receptor, which leads to an increase in muscle tone and rigidity. Copeptin is also used as a research tool for studying protein interactions, antibody-antigen reactions, cell biology, ligand-receptor binding, pharmacology and life sciences. Copeptin has been shown to inhibit ion channels such as nicotinic receptors and potassium channels. The CAS number for copeptin (rat) trifluoroacetate salt is 86280-64-0.</p>

<p>Please enquire for more information about Serpinin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>

<p>Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is a peptide hormone. It has been shown to be an opioid that binds to the μ and δ opioid receptors and inhibits the production of inflammatory mediators. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt has also been shown to have neuroprotective effects. This drug has low potency and can only be used in vivo models. Biphalin trifluoroacetate salt (H-Tyr-D-Ala-Gly-Phe-NH)2 trifluoroacetate salt is not active against skin cancer cells, but does show activity against other types of cancer cells.</p>

<p>N,N'-Dibenzylethylenediamine diacetate is a diagnostic agent that is used to detect penicillin in blood samples. It reacts with the drug by forming a red-colored product, which can be detected with an ultraviolet light. This reaction is inhibited by cefapirin sodium and benzathine. The detection of penicillin in maternal blood has been shown to be significantly higher during the first trimester of pregnancy than during any other time period. Penicillin has also been shown to be effective against syphilis and streptococcal pharyngitis (strep throat), although it is not recommended for treatment trials because of its tendency to cause allergic reactions.</p>

<p>Please enquire for more information about H-Cys(NPys)-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Pancreatic Polypeptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Ala1·3·11·15)-Endothelin-1 trifluoroacetate salt H-Ala-Ser-Ala-Ser-Ser-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu) is a phorbol ester, which is an analog of endothelin. It has been shown to inhibit the production of proinflammatory cytokines and chemokines in vitro and in vivo. This compound also inhibits the migration and proliferation of vascular endothelial cells, which may be due to its ability to suppress Ca2+ concentration. (Ala1·3·11·15)-Endothelin -1 trifluoroacetate salt H-) can also be used as a fluorescent marker for immunohistochemical studies on tissues such as vessels and gastrointestinal tissues. The localization of this drug can be observed by microscopy techniques such as</p>

<p>Please enquire for more information about (Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Cys18)-Atrial Natriuretic Factor (4-18) amide (mouse, rabbit, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Leu-Ser-Lys-Leu-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pep-1-cysteamide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dodecylbenzenesulfonic acid is a sulfonic acid that is used in the production of polyaniline. It is also used as an organic reagent that can be applied in organic synthesis, including polymerization and electrochemical studies. Dodecylbenzenesulfonic acid has been shown to react with sodium salts to form dodecyl benzene, which can be observed by synchronous fluorescence spectroscopy. This chemical has a phase transition temperature of -9°C and a boiling point of 176°C. Dodecylbenzenesulfonic acid is soluble in water vapor, but insoluble in ethanol or acetone.</p>

<p>Eglin C (60-63)-methyl ester acetate salt H-Thr-Asn-Val-Val-OMe acetate salt is a novel, potent cathepsin inhibitor that has inhibitory effects on leukocyte elastase. It is a hydrophobic and highly lipophilic molecule with a high degree of solubility in organic solvents. The amino acid residues are the key functional group responsible for the inhibitory effects of Eglin C.</p>

<p>SN50 is a nuclear factor NF-KB inhibitor that blocks the activity of transcription factors that are involved in inflammation and cancer. SN50 inhibits protease activity, which may be due to its ability to bind to response elements on DNA, leading to cytosolic calcium release and activation of signal pathways. It also binds to endothelin-a receptor and induces apoptosis. SN50 has been shown to have anti-tumour effects in resistant breast cancer cells as well as reducing serum aminotransferase levels in rats. This drug also activates transcriptional regulation by binding toll-like receptors and inducing colony stimulating factors. SN50 also has cardioprotective properties, which may be due to its ability to inhibit fatty acid synthase in cardiomyocytes.</p>

<p>Bis-ACV trifluoroacetate salt is a regulatory compound that belongs to the class of bis-acids. It is a cytosolic calcium ionophore that binds to the cytosolic calcium ion channel and regulates its activity. Bis-ACV trifluoroacetate salt also has nucleophilic attack on phosphate groups, which are essential for biosynthesis. The enzyme activity of this compound has been studied in various strains of bacteria such as E. coli and S. cerevisiae, and it was found to be involved in the synthesis of oligosaccharides and polysaccharides. This compound can be solubilized by the addition of sodium bicarbonate or urea, which facilitates its use in synthetic reactions. The synthase gene for this compound has been identified from various strains of bacteria such as E. coli and S. cerevisiae, but not from mammalian cells or plants.</p>

<p>Trifluoroacetate salt</p>

<p>Intermediate in the synthesis of dapagliflozin</p>

<p>Please enquire for more information about Amyloid b-Protein (6-20) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PHM-27 is a human protein that contains a c-terminal histidine and n-terminal lysine. It contains an amino acid composition of histidine, valine, alanine, aspartic acid, glycine, serine, threonine, arginine, and methionine. PHM-27 is present in the cardiovascular system, nervous system, gastrointestinal system, and respiratory system. It has been shown to be involved in the synthesis of peptides important for blood clotting.</p>

<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.</p>

<p>Please enquire for more information about Kyotorphin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>7-Amino-3-vinyl-3-cephem-4-carboxylic acid (AVC) is a synthetic, inorganic acid that is used clinically. It is produced by the hydrolysis of chlorocarboxylic acids and has been shown to be effective as an antihypertensive agent. AVC has also been used as a catalyst for acylation reactions with chlorides and trifluoroacetic acid. This process yields a reaction yield that can be up to 95% with the use of catalysts such as aluminum chloride or zinc chloride. AVC has been shown to be an environmentally safe alternative to hydrogen chloride, which has been linked to environmental pollution.</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Hydroxysuccinic acid methyl ester is an organic compound that has a carbonyl group, a hydroxyl group, and two carboxylic esters. It is a colorless liquid with a sweet taste. 2-Hydroxysuccinic acid methyl ester is classified as a dicarboxylic acid. It can be found in nature as malic acid, which is found in apples and other fruits. 2-Hydroxysuccinic acid methyl ester can also be synthesized from citric acid and formaldehyde.</p>

<p>Please enquire for more information about SPLUNC1 (22-39) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>

<p>Please enquire for more information about Biotinyl-(Gln1)-LHRH trifluoroacetate salt Biotinyl-Gln-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>

<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 6-bromo-1,2-dihydro-2-oxo-4-pyridineacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-4,5-dimethoxybenzoic acid is a synthetic compound that belongs to the group of anticancer drugs. It is a potent inhibitor of mitochondrial membrane depolarization and has been shown to inhibit tumor growth in vivo. 2-Bromo-4,5-dimethoxybenzoic acid also induces cell death by demethylation and hydroxylation of DNA, leading to apoptosis. This compound is synthesized by reacting 3,4-dihydroxybenzoic acid with bromine and potassium hydroxide. Surrogates such as amides are used for this synthesis because the original product is not stable enough. Protocatechuic acid can be produced from 2-bromo-4,5-dimethoxybenzoic acid through hydrolysis.</p>

<p>Please enquire for more information about H-Asn-Gln-Glu-Gln-Glu(EDANS)-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>

<p>Propanedioic acid 1-methyl ester (PDM) is a synthetic trifluoroacetic acid ester of the natural fatty acid, propanedioic acid. It has been found to be a potent inhibitor of the enzyme malonic acid decarboxylase in vitro and has also been shown to inhibit the production of prostaglandin E2 in mice with adjuvant arthritis. PDM is used as a diagnostic agent for autoimmune diseases and inflammatory diseases. It is also being studied as an anti-inflammatory drug for use in the treatment of chronic inflammatory conditions such as rheumatoid arthritis, psoriasis, and ulcerative colitis. The mechanism of action is not well understood but may involve inhibition of arachidonic acid metabolism or inhibition of cyclooxygenase enzymes.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Oxo-1-adamantanecarboxylic acid is a versatile building block that can be used as a reactant and reagent in organic chemistry. It is used to synthesize various heterocyclic compounds, including the 4-oxo-1,4-dihydropyridine ring system. This compound has been shown to be useful as an intermediate or building block in the synthesis of a number of complex compounds. 4-Oxo-1-adamantanecarboxylic acid may also be used as a research chemical or speciality chemical.</p>

<p>Enterostatin is a peptide hormone that inhibits the release of insulin, gastric acid and pancreatic juices. Enterostatin has been shown to have a number of biological properties, including an anti-obesity effect in humans. In mice, enterostatin has been shown to decrease food intake, increase energy expenditure and weight loss. Enterostatin also decreases the levels of serum cholesterol and triglycerides in rats. This drug has a number of pharmacological activities including inhibition of platelet aggregation and vasodilation. Enterostatin is related to peptide hormones such as ghrelin, which stimulates appetite, and cholecystokinin (CCK), which reduces appetite. It may be used as an alternative treatment for obesity or metabolic disorders like diabetes mellitus type 2 or hyperlipidaemia.</p>

<p>Please enquire for more information about RVG-9R trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Chloromethyl acetate is a potent antibacterial agent that inhibits the growth of bacteria by inhibiting the synthesis of fatty acids. It also has an inhibitory effect on adenosine receptors and is used to treat congestive heart failure, inflammatory diseases, metabolic disorders, and other conditions. Chloromethyl acetate has been shown to be effective against a number of bacterial strains, including methicillin-resistant Staphylococcus aureus (MRSA), Streptococcus pneumoniae, and Mycobacterium tuberculosis. Chloromethyl acetate binds to the cyanoformate group in the bacterial cell wall by competitive inhibition. This binding prevents the formation of an antibiotic-inhibitor complex with the enzyme fatty acid synthase that is required for fatty acid biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Tetrabutylammonium acetate is a complex of tetrabutylammonium with the trifluoroacetate anion. It has been used as a reagent for the preparation of α-hydroxylated ketones, including natural products. Tetrabutylammonium acetate can be used in titration calorimetry to measure the heat evolved during the reaction between hydroxyl group and sodium salts. The heat released corresponds to the amount of water produced from this reaction. In this way, it can be determined whether or not a molecule contains an active hydrogen atom. Tetrabutylammonium acetate also reacts with reactive compounds such as dpp-iv inhibitors, forming a reactive intermediate that cannot be isolated due to its instability. This intermediate is detected by analytical methods such as plasma mass spectrometry or infrared spectroscopy. Tetrabutylammonium acetate also reacts with asymmetric synthesis, forming an intram</p>

<p>3-Keto-4-etiocholenic acid is a type of fatty acid that is naturally found in the human body. It is produced by the oxidation of other types of fatty acids and is an intermediate in the synthesis of sex hormones. 3-Keto-4-etiocholenic acid can be synthesized by recombinant methods, which are used to produce proteins for research purposes. It has been shown to have cytostatic effects, which may be due to its irreversible inhibition of enzymes involved in biological function.</p>

<p>4-Amino-3,5,6-trichloropyridine-2-carboxylic acid (4ATC) is a herbicide that inhibits the activity of pyridoxal phosphate (PLP)-dependent enzymes. 4ATC has been shown to be more toxic to plants than temozolomide and is used in vitro to study the effects of herbicides on cells. It inhibits cell growth and induces apoptosis in human cancer cells. In addition, 4ATC has been shown to inhibit the enzyme activities of group P2 proteins and nucleic acid synthesis. 4ATC also inhibits protein synthesis by inhibiting RNA synthesis in eukaryotic cells. 4ATC is not active against bacteria or fungi.</p>

<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Diisopropyl azodicarboxylate is a chemical compound that reacts with hydrogen fluoride to form a mixture of diazo and triazole products. The chemical reaction is the first step in the synthesis of many pharmaceuticals, such as penicillin. Diisopropyl azodicarboxylate is used in eye disorders, metabolic disorders, and autoimmune diseases. It has been shown to be effective in treating bowel disease. This drug has been shown to have chemotherapeutic properties, which may be due to its ability to inhibit protein synthesis by binding to the nitrogen atoms on receptor molecules. Diisopropyl azodicarboxylate also reacts with trifluoroacetic acid, forming a disulfide bond that can be analyzed using structural analysis techniques or reaction solution methods.</p>

<p>Please enquire for more information about CART (61-102) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Glutamic acid alpha-amide is an ester hydrochloride that is a tissue culture amide. It is a cyclic peptide analog and a hydroxyl group. L-glutamic acid alpha-amide has been shown to inhibit the inflammatory response in the bowel disease, Crohn's disease, by blocking the toll-like receptor 4 and 5. This drug also inhibits protein synthesis, which may be due to its ability to bind to fatty acids, thereby inhibiting the production of proteins vital for cell division.</p>

<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt of HIV-1 gag Protein p17 (76-84) is a reactive acridone, hydrocarbon, nitrogen atom and hydrates that is injected to regulate depression. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to bind to the telomerase enzyme and inhibit cancer cell growth. Acetate salt of HIV-1 gag Protein p17 (76-84) also has a role in regulating metabolism in cells. Acetate salt of HIV-1 gag Protein p17 (76-84) has been shown to have solvating properties and can be used as a heterocyclic ring section in gas phase reactions.</p>

<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>