Carboxylic Acids

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>tert-Butyl carbamate is a chemical compound that has been shown to inhibit the ubiquitin ligases, which are enzymes responsible for protein degradation. It binds to the active site of these enzymes and inhibits their activity. Tert-butyl carbamate has also been shown to have anti-inflammatory properties due to its ability to inhibit prostaglandin synthesis. This drug has been shown to be safe in humans at high doses and has a low toxicity profile.</p>

<p>Please enquire for more information about pTH (1-84) (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Lys6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a hormone that is produced in the kidneys and acts on the blood vessels, heart, and other tissues. It is also known as angiotensin II acetate salt H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH acetate salt. Angiotensin II can increase blood pressure by constricting blood vessels and causing the release of aldosterone from the adrenal glands. This hormone also causes smooth muscle contraction in various organs, including the intestines. The synthesis of angiotensin II occurs through two different pathways: one involving renin and another involving prorenin. The renin pathway begins with renin converting angiotensinogen into angiotensin I, which is then converted to angiotensin II by angiotensins I converting enzyme (ACE). Angiotensin II has been shown to increase protein phosphorylation in myosin, leading to increased</p>

<p>Please enquire for more information about Formyl-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Ala-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Glu5)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pp60 c-src (521-533) (phosphorylated) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Difluoromethoxyphenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Leu31,Pro34)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-p-Chloro-Phe-D-Cys-b-(3-pyridyl)-Ala-D-Trp-N-Me-Lys-Thr-Cys-2-Nal-NH2 trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tyr-Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Lys-D-Ala-D-lactic acid·acetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Lys18)-Pseudin-2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>GRP (14-27) is a synthetic peptide that has an inhibitory effect on the growth of pancreatic cancer cells. It also inhibits the development of primary tumors in hamsters and inhibits tumor metastasis. GRP (14-27) binds to the cell surface receptor on T cells, which is responsible for mediating immune responses against tumors. GRP (14-27) has been shown to suppress tumor growth through immunoreactivity and has been found to be effective against a variety of cancers when used as an adjuvant therapy.</p>

<p>3-Chlorophenyl acetic acid is a compound that has resonance mass of 269. The compound reacts with HBr and water to produce 3-chlorobenzene, carbon dioxide and hydrogen chloride. A reaction product of this chemical is covid-19 pandemic (a type of drug). 3-Chlorophenyl acetic acid is an organic acid that can be found in tobacco plants. It has a molecular weight of 111.07 g/mol, and its molecular formula is C6H3ClO2. The compound can exist in two forms: cis-3-chloroacrylic acid and trans-3-chloroacrylic acid. One of the two forms isomers may be more efficient than the other form for a given reaction or application.</p>

<p>Bromofluoroacetic acid is a synthetic, chiral molecule with the chemical formula CF3CO2H. It has the molecular weight of 109.07 and a boiling point of 212 °C. Bromofluoroacetic acid is used in industry as an intermediate for fluoroacetic acid. It is also used to manufacture bromofluorocarbons, which are used as propellants in aerosol sprays. Bromofluoroacetic acid has been studied in clinical studies as a treatment for epilepsy and as an antimicrobial agent against bacteria such as Staphylococcus aureus and Enterobacter aerogenes.</p>

<p>Please enquire for more information about H-Gly-His-Arg-Pro-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dimercaptosuccinic acid is a chemical that belongs to the class of dithiols. It has been used for the treatment of squamous cell carcinoma and urinary tract infections. Dimercaptosuccinic acid has shown long-term toxicity in rats and mice, with increased urinary bladder damage and decreased renal function. Dimercaptosuccinic acid is a fluorescent probe that can be used to diagnose oxidative injury in rats. It also binds to disulfide bonds in proteins, which can be quantified using plasma mass spectrometry.</p>

<p>Ethyl 4-bromoacetoacetate is a chemical compound that is used in the synthesis of quinoline derivatives. It also has antiinflammatory properties and can be used to treat inflammatory diseases such as arthritis. The thermal expansion of this compound is greater than that of water, which can be useful in treating respiratory problems by providing increased oxygen transport. Ethyl 4-bromoacetoacetate is a reactive chemical that reacts with hydrochloric acid to produce hydrogen gas and ethyl bromide gas. It also undergoes nucleophilic substitutions at the carbon atom adjacent to the acetoacetate group. This reaction solution can be analyzed using magnetic resonance spectroscopy, which produces data on the sequences of this compound's atoms and its antiinflammatory activity.</p>

<p>4-tert-Butylphenylboronic acid is an aromatic hydrocarbon that belongs to the class of phenoxy. It is a molecule with nitrogen atoms and a molecular weight of 144.17 g/mol. 4-tert-Butylphenylboronic acid has been shown to form a copper complex in the presence of sodium trifluoroacetate, which is used for cross-coupling reactions. This compound also reacts with hydrochloric acid to form 4-methoxyphenylboronic acid and trimethyl boronate, which can be used as reaction products in organic synthesis. The stability of this compound has been studied using electrochemical impedance spectroscopy (EIS) on thin films.</p>

<p>Please enquire for more information about Met-RANTES (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Benzyl acetate is a colorless liquid that has a pleasant odor. It is used as a flavoring agent in food, beverages and tobacco products. Benzyl acetate is also used as an intermediate in the production of other chemicals. A low-dose group of rats was given benzyl acetate at doses of 0.5, 1, 5 and 10 mg/kg/day for 30 days. The animals were observed for changes in enzyme activities and thermal expansion reactions. Chronic exposure to benzyl acetate may cause carcinogenesis by inducing dimethyl fumarate (DMF) or methyl transferase activity.</p>

<p>Please enquire for more information about PAR-2 (6-1) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Tyr-Tyr-Phe-OH acetate salt is a reaction product of the matrix-assisted laser desorption ionization (MALDI) technique. It is an analog of tyrosine, with a hydroxyl group substituted for the amino group. The protonation state of this molecule has been determined by the hydration constant and the centroid to be a neutral pH. Using hydrogen bonding, H-Tyr-Tyr-Phe-OH acetate salt binds to the mitochondria in cells, which may lead to a higher rate of reaction.</p>

<p>Please enquire for more information about (D-Ala6)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-Gly-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-Arg-OH acetate salt is an antioxidant that belongs to the group of amino acids. It has been shown to have antioxidative activity in vitro, as well as interaction with radicals and free radicals. Cryo-electron microscopy was used to show this compound's radical scavenging activity. H-Ile-Arg-OH acetate salt has also been found to have antioxidative properties in eukaryotes. This compound is composed of two isomers: H-Ile and Arg. The hydroxyl group on the H-Ile isomer gives this compound its antioxidative properties, while the Arg isomer possesses hydrolytic properties. The subunits are linked together by a peptide bond between the carboxyl group on Arg and the amine group on H-Ile. In addition, H-Ile has an -OH hydroxyl group that can be scavenged by hydroxyl radicals, which provides antioxidative activity.</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (403-407) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hemimellitic acid is a carboxylate that has an intramolecular hydrogen and a reactive hydroxyl group. It can be used as a precursor to the production of polymers and plastics. Hemimellitic acid is an inorganic acid that contains nitrogen atoms. It can exist as particles with a size range between 1 and 100 nanometers. The chemical structure of hemimellitic acid is related to the malonic acid; it is the methyl ethyl ester of malonic acid. Hemimellitic acid has thermodynamic data, including a standard enthalpy change of -3,079 kJ/mol (-8,726 cal/mol) and Gibbs free energy change of -2,837 kJ/mol (-6,927 cal/mol).</p>

<p>Please enquire for more information about Dynorphin A (1-13) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-(4-Phenylbutoxy)benzoic acid is an organic compound that is produced by the reaction of 4-hydroxybenzoic acid with a Grignard reagent. The 4-hydroxybenzoic acid reacts with magnesium to form magnesium chloride and p-hydroxybenzoic acid, which then reacts with a Grignard reagent to form the desired product. This compound has been used in wastewater treatment and as an intermediate in the synthesis of dyes, perfumes, and pharmaceuticals. 4-(4-Phenylbutoxy)benzoic acid has also been used as a starting material for synthesizing other compounds such as chlorobenzene and p-hydroxybenzoic acid.</p>

<p>Please enquire for more information about LIP2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tetrafluorobenzoic acid is a synthetic chemical that is used in the synthesis of antimicrobial agents. Tetrafluorobenzoic acid has been shown to bind to the hydroxyl group of 2,3,4,5-tetrafluorobenzoyl chloride and form a covalent bond. The reaction solution was analyzed using crystallography and showed that there are no intermolecular hydrogen bonds between tetrafluorobenzoic acid molecules. The crystal structure was determined by X-ray diffraction analysis and found that the intramolecular hydrogen bonding may be responsible for the anti-microbial activity of this substance.</p>

<p>Tert-butyl cis-4-hydroxycyclohexylcarbamate is a pharmacological agent that has been shown to have anticonvulsant activity. It is a phenytoin amide that has neurotoxic effects and can cause convulsions. Tert-butyl cis-4-hydroxycyclohexylcarbamate binds to the sulfonamide site on the enzyme GABA transaminase, which converts GABA into succinic semialdehyde, thereby inhibiting the synthesis of GABA. This drug also inhibits the production of acetaldehyde from ethanol by preventing oxidation of NADH and NADPH. The tert-butyl cis-4-hydroxycyclohexylcarbamate was found to have an anticonvulsant effect in animals when given intravenously and orally. It also showed a protective effect against electroshock seizures in rats, suggesting an anticonvulsant activity.</p>

<p>Please enquire for more information about H-Gly-Lys-His-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Substance P is a tachykinin neuropeptide that belongs to the tachykinin family. It is found in the central and peripheral nervous system and has been shown to have an important role in locomotor activity, protein synthesis, receptor activity, and neurotransmitter release. Substance P is also associated with a number of diseases such as infectious diseases, sciatic nerve pain, and vasoactive intestinal peptide (VIP) production. This substance has been used for the diagnosis of neurogenic bladder dysfunction by measuring its effects on urinary bladder contractility.</p>

<p>Please enquire for more information about (Phe2, Nle 4)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide F trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neurotensin is a peptide hormone that regulates the release of other hormones and neurotransmitters, such as dopamine. It has been shown to be able to regulate appetite and bowel disease in animal models. Neurotensin acetate salt Pyr-Leu-Tyr-Glu-Asn-Lys-Pro-Arg-Arg-Pro-Tyr-Ile-Leu-OH acetate salt is a neurotensin molecule with an acetate group attached to it. This molecule is completely soluble in water and has been shown to have no effect on energy metabolism or polymerase chain reactions.</p>

<p>H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.</p>

<p>Vinylboronic acid MIDA ester is a boronic ester that can be used as an additive to control weeds. It is a mixture of two diastereomers, with the vinyl group on one end of the molecule and the boron atom on the other. Vinylboronic acid MIDA ester has been shown to be more effective than methoxy for weed control, with yields of up to 100%. The addition of this compound to herbicides increases their activity against weeds, which may be due to its ability to increase the solubility of active ingredients.</p>

<p>Please enquire for more information about (D-His2,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Pro-Leu-Ala-Cys(Mob)-Trp-Ala-Arg-Dap (Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Met-Enkephalin acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Oxyntomodulin (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Arg-Gly-Glu-Ser-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tert-Butyl allylcarbamate is a fluorinated, reactive compound that has been used in the synthesis of amines and phosphazenes. Tert-Butyl allylcarbamate is an intermediate for the synthesis of isophthalaldehyde, which can be used to produce polymers and other organic compounds. The reaction rate of tert-butyl allylcarbamate is inhibited by phosphazene, which also inhibits polymerization. Tert-Butyl allylcarbamate has been shown to inhibit transfer reactions involving functional groups such as allylamine, silicon, and fluoroalkyl.</p>

<p>Please enquire for more information about H-Pro-Phe-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg8)-Conopressin G trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DL-4-Hydroxymandelic acid is a phenolic acid that belongs to the family of organic acids. It is synthesized from 4-hydroxyphenylpyruvate and p-hydroxybenzoic acid by an enzyme called hydroxylase in the liver. The frequency shift in DL-4-Hydroxymandelic acid is caused by the hydrogen bonding between its hydroxyl group and pyran ring. This reaction occurs spontaneously, with no need for a catalyst or a change in pH. The reaction mechanism starts with the addition of water to the molecule, which results in an intermediate that breaks down into two molecules of formaldehyde and one molecule of formate. The reaction solution was found to be acidic because it contained H+ ions (H+).</p>

<p>Chlorotoxin trifluoroacetate salt is a chlorotoxin derivative that has been modified to be more soluble in aqueous solutions. It is used to identify skin cancer and other forms of cancer, as well as for the study of cellular function and structure. The molecule can be injected into tissue or cells, where it binds to nuclei and causes cell death. Chlorotoxin trifluoroacetate salt has minimal toxicity in humans and can be used on histological specimens with little disruption to the tissue. This reagent may also be used to target intracellular targets such as glioma cells.</p>

<p>Please enquire for more information about Alpha-Helical CRF (9-41) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH acetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt acetate salt is a synthetic hormone that belongs to the group of gonadotropin releasing hormones (GnRH). It is used in veterinary medicine to stimulate ovulation and follicular growth in animals. (Des-Gly10, tBu-D-Gly6, Pro -NHEt9)-LHRH acetate salt Pyr -His -Trp -Ser -Tyr -tBu -D -Gly -Leu -Arg -Pro NHEt acetate salt is a prodrug that is hydrolyzed in vivo to buserelin, its active form. This drug has been shown to be effective against estradiol benzoate and sodium salts</p>

<p>2-Pyridineboronic acid is a chemical compound that belongs to the group of quinoline derivatives. It is used in pharmaceutical preparations, including as an intermediate for the synthesis of other compounds. 2-Pyridineboronic acid has been shown to have antiproliferative effects on cancer cells and has been found to be active against nicotinic acetylcholine receptors (NAR). The compound also inhibits lipid kinase activity, which is involved in the production of phosphatidylcholine and phosphatidylethanolamine from phosphatidylserine. 2-Pyridineboronic acid can react with hydrochloric acid and electrochemical impedance spectroscopy to produce a solution that has a detection time of about 10 minutes.</p>

<p>Bombesin is a peptide hormone that is secreted by the intestines and the pancreas. Bombesin stimulates the adrenal glands to release adrenaline, which in turn stimulates the bladder to contract. Bombesin has been shown to increase bladder efficiency significantly when given intravenously to patients with chronic urinary retention. This drug also has significant effects on pain syndrome, as it can facilitate or inhibit pain depending on its concentration. Bombesin's mechanism of action is still unclear, but it may work by antagonizing other neurotransmitters like noradrenaline or adrenaline.</p>

<p>Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dynorphin A (1-10)-Gly-chloromethylketone trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,5-Dichloropyrazine-2-carboxylicacid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hemokinin-1 is a hematopoietic cell growth factor that belongs to the group of neuropeptides. This protein has been shown to stimulate the production of white blood cells and is used as an adjuvant in vaccines. Hemokinin-1 stimulates the production of inflammatory cytokines and other proinflammatory substances. It also has been found to be involved in autoimmune diseases, cancer, and infectious diseases. The antigen binding site on Hemokinin-1 is located at residues Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu (TGLKSGPFGL) and the receptor binding site at residues Met-NH2. The receptor for Hemokinin 1 is the neurokinin 1 receptor (NK1R).</p>

<p>Please enquire for more information about H-Phe-Met-D-Arg-Phe-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>

<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Glu-Ala-Leu-Phe-Gln-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Trp11,D-Phe15·16)-SDF-1 (7-16) (Dimer) (human, cat, mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-epsilon-aminocaproic acid-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Beta-MSH is a hormone that belongs to the peptide hormones group. It is synthesized in the pituitary gland and released in response to stress, trauma or injury. Beta-MSH has been shown to regulate many physiological functions, including adrenocorticotrophic hormone (ACTH) secretion, skin pigmentation and regulation of body temperature. Beta-MSH also has diagnostic applications as it can be used to measure levels of this hormone in cerebrospinal fluid (CSF). The n-terminal prohormone fragment of beta-MSH can be measured by radioimmunoassay (RIA) or enzyme immunoassay (EIA), while the c-terminal prohormone fragment can be measured by RIA.</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Boc-isonipecotic acid is a potent antitumor agent that has been clinically shown to be effective against leukemia and lymphoma. It has potent antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus and Streptococcus pyogenes. N-Boc-isonipecotic acid binds to the gyrase enzyme, which is used by these bacteria to maintain the integrity of their DNA, inhibiting protein synthesis and cell division. This drug also has anti-inflammatory properties. N-Boc-isonipecotic acid inhibits prostaglandin synthesis in cells, which may be due to its ability to inhibit the production of tumor necrosis factor α (TNFα) in macrophages.</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>

<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(4-Fluorobenzoyl)propionic acid (3FBP) is a novel, orally active dopamine D4 receptor agonist. 3FBP binds to the D4 receptor with high affinity and has been shown to have potent antinociceptive effects in CD-1 mice. The compound has also been shown to be effective in reducing locomotor activity in rats, as well as inducing motor impairment and catalepsy in mice. 3FBP does not produce any significant changes in striatal dopamine levels, suggesting that it may have a different mechanism of action than traditional dopaminergic drugs.</p>

<p>Palmitoleic acid methyl ester is a bio-based chemical that can be used in wastewater treatment. It has been shown to inhibit the activity of lipase, an enzyme that catalyzes the hydrolysis of triglycerides, and may be useful for the removal of fatty acids from wastewater. Palmitoleic acid methyl ester has a phase transition temperature of about 120°C and a thermal expansion coefficient similar to polyethylene. This product was found to be a good solid catalyst for the production of nitric oxide from nitrogen atoms. The antioxidant vitamins C and E were found to have synergistic effects with palmitoleic acid methyl ester. This product also has antimicrobial properties against infectious diseases such as tuberculosis, which may be due to its ability to inhibit protein synthesis by disrupting ribosomal function.</p>

<p>The solute-solvent interaction is the process in which solutes are dissolved in a solvent. The solute is the substance that is dissolved and the solvent is the liquid that holds the solute. There are two types of interactions between an ionic solute and a polar solvent: electrostatic and hydrophobic. Electrostatic interactions are due to charge differences, while hydrophobic interactions are due to differences in molecular size or shape. In simulations, molecular dynamics was used to study how ligands interact with receptors using a thermodynamic model system. A frequency shift was observed when ligand binding occurred, which indicates that binding can be detected by monitoring changes in frequency.</p>

<p>Please enquire for more information about Galanin-Like Peptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Amino-2-oxoethoxy)acetic acid is a product that can be used as a transport agent in the process of extracting glycosides. It has been shown to have strong adsorption properties and is able to extract glycosides from plant material. 2-Amino-2-oxoethoxy)acetic acid has a high affinity for calcium, which is an important component in the adsorption mechanism.</p>