Carboxylic Acids

<p>Please enquire for more information about (Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.</p>

<p>Fulvic acid is a natural organic compound that has been used in clinical and biological properties. It is a fluorescent molecule with a high quantum yield, which makes it an ideal candidate for use as a fluorescence probe. Fulvic acid has been shown to form stable complexes with malonic acid, which may be due to the strong hydrogen bonding interactions between these two molecules. The fluorescence emission spectrum of fulvic acid is sensitive to the pH of the reaction solution, and it can be used as a thermodynamic data indicator. Fulvic acid also has low toxicity, which makes it suitable for use in laboratory studies.</p>

<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>

<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Pyridylboronic acid pinacol ester is a versatile reagent that can be used in the synthesis of polymers with reactive functionalities. This compound is a crosslinker, which means that it reacts with two or more other molecules to form a covalent bond. 3-Pyridylboronic acid pinacol ester has been shown to react with ring-opening methacrylate monomers and expand their polymer backbone, which leads to an increase in the number of reactive groups on the chain. The introduction of 3-pyridylboronic acid pinacol ester can also introduce fluorescent units into polymers for use as probes for biological systems. There are many possible applications for this versatile reagent, including its use in the synthesis of imidazopyridine ligands.</p>

<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>

<p>Please enquire for more information about (Val671)-Amyloid b/A4 Protein Precursor770 (667-676) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Methyl 4-(3-methoxyphenyl)-6-methyl-2-thioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Pro-Tyr-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>RF9 is a dipeptide that is structurally similar to the endogenous neuropeptides kisspeptin and arginine-vasopressin. RF9 binds to the GPR54 receptor, which is a G protein-coupled receptor that regulates secretion of luteinizing hormone in the anterior pituitary gland, as well as sexual desire and function. RF9 has been shown to be an antagonist of the GPR54 receptor and has been shown to inhibit the secretion of luteinizing hormone in primates.</p>

<p>4-(Trimethylsilyl)phenylboronic acid is a molecule that can be used as an acceptor in fluorescence. It has been shown to have acceptor properties, which means it is able to absorb light energy and transfer it to other molecules. This chemical can be used in microscopy and cross-coupling reactions. 4-(Trimethylsilyl)phenylboronic acid has been shown to undergo thermally activated transport properties and to be isomeric. The molecule also has cross-coupling reactions with anilines, which are important for the production of pharmaceuticals and other organic compounds. 4-(Trimethylsilyl)phenylboronic acid has a high affinity for chloride ions, making it a good candidate for use in solar cells.</p>

<p>Please enquire for more information about Toxin GaTx1 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Z-Leu-Arg-Gly-Gly-AMC acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mixture of 1, 2 and cyclic phosphates.<br>Glycerophosphoric acid is a fatty acid that is naturally found in the body. It has been shown to have an effect on the production of enzymes and proteins in cells, which may be related to its metabolic rate.</p>

<p>Please enquire for more information about Hepcidin-24 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Trifluoroacetate salt</p>

<p>4-Methylbenzyl acetate is a monocarboxylic acid that is an oxidation product of benzyl esters. It has been found to be a suitable catalyst for the oxidation of wastewater containing monocarboxylic acids, including acetic acid, propionic acid and butyric acid. The catalytic mechanism of 4-methylbenzyl acetate was found to be an acylation reaction in which the carboxyl group of 4-methylbenzyl acetate acts as an acylating agent with the hydrogen atom of the substrate. The reaction mechanism for this process is similar to that for other types of carboxylic acids, such as propionate and butyrate. 4-Methylbenzyl acetate also has functional groups that allow it to act as both a base and a nucleophile in addition to its ability to act as an acylating agent.</p>

<p>Please enquire for more information about (1S,2R)-Fmoc-aminocyclohexane carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid is a fine chemical that is used in research and as a reagent. It is also used as a building block for more complex compounds and as a versatile scaffold in organic synthesis. 2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid can be reacted with other chemicals to create new compounds. This chemical has been shown to have antihistamine properties and may also function as an antipsychotic drug.</p>

<p>Methylboronic acid pinacol ester is an orally administered compound that inhibits the activity of peptidases and imidazole derivatives. It is used as a medicinal preparation for the treatment of cancer and other diseases. Methylboronic acid pinacol ester has been shown to inhibit the growth of bacteria, including Gram-positive bacteria such as methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens. This compound also has an inhibitory effect on hydroxyl group metabolism, which may be related to its anti-inflammatory properties.</p>

<p>Please enquire for more information about (Leu31,Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Iodo-5-methoxybenzoic acid is a macrocyclic compound that has been synthesized in the Wittig reaction. It was first prepared by catalyzed intramolecular aryl demethylation of 2-iodo-5-nitrobenzoic acid, followed by coupling with methyl vinyl ketone. The cytotoxic activity of this compound is due to its ability to inhibit the synthesis of protein and DNA and induce apoptosis. This molecule has been shown to be effective against liverworts and ethers.</p>

<p>Please enquire for more information about Vasonatrin Peptide (VNP) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (His(1-Me)2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Intermedin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cys-Gly-Lys-Lys-Gly-Amyloid b-Protein (33-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1H-Pyrrole-2,5-dicarboxylic acid is a biosynthetic precursor of the amide functional group. It is synthesized from the carboxylic acid functional group and ferrocene. It has been shown to be a putative precursor of pyrrole-2-carboxylic acid in the pyrrole system. 1H-Pyrrole-2,5-dicarboxylic acid reacts with carbon tetrachloride and diethyl iminodiacetate in refluxing chloroform to produce coelicolor. The reaction mechanism for this transformation is unknown, but it is hypothesized that it involves a radical mechanism.</p>

<p>Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt is a synthetic peptide that is derived from the amino acid sequence of caspases. Ac-Leu-Glu-His-Asp-AMC trifluoroacetate salt induces apoptosis in insect and E. coli cells by protease activity, which leads to cell death. The sequence of this peptide is found in Drosophila melanogaster and has been shown to induce apoptosis in insect cells. Caspases are enzymes that regulate apoptosis and play a key role in cell death.</p>

<p>Amide; Trifluoroacetate salt</p>

<p>Please enquire for more information about H-Lys-Lys-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fibronectin Fragment (1954-1959) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Urotensin II is a peptide that is expressed in the brain and has hypotensive effects. It is an endogenous ligand for the urotensin II receptor, which is found in various tissues including the heart, vascular system, and lungs. Urotensin II-Related Peptide (URP) was identified from cDNA sequences of human, mouse, and rat tissues. The URP consists of a sequence of amino acids with a molecular weight of 1219. This peptide has been shown to have diagnostic use in tissues and animals as well as being immunoreactive in monoclonal antibodies. The gene encoding URP has been cloned and its protein product has been characterized by mass spectroscopy.</p>

<p>Please enquire for more information about tert-Butyl 1-oxa-4,9-diazaspiro[5.5]undecane-9-carboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyromeconic acid is a trifluoroacetic acid derivative that has been shown to have anti-inflammatory properties. Pyromeconic acid has a redox potential of -0.07 V at pH 7 and can act as a reducing agent in biological systems. It has been shown to inhibit the methylation of pueraria lobata and the transferase activity of methionine synthase, which plays a role in the synthesis of proteins. Pyromeconic acid also inhibits the production of sesquiterpene lactones in carthamus tinctorius, which are responsible for its anti-inflammatory effects. It is an acidic chemical that contains a hydroxyl group and coordinates with metals such as copper, zinc, and nickel.</p>

<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>