Carboxylic Acids
Carboxylic acids are organic molecules characterized by having a carboxyl-type functional group (-COOH). These acids are fundamental in various chemical reactions, including esterification, amidation, and decarboxylation. Carboxylic acids are widely used in the production of pharmaceuticals, polymers, and agrochemicals. In this section, you can find a large number of carboxylic acids ready to be used. At CymitQuimica, we provide a broad range of high-quality carboxylic acids to support your research and industrial applications.
Found 12456 products of "Carboxylic Acids"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
(D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:Please enquire for more information about (D-Trp32)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C197H290N56O56Purity:Min. 95%Molecular weight:4,338.75 g/molZ-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt
CAS:Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt is a proteolytic enzyme that has been shown to have bone resorption and tissue destructive properties. It is active against porphyromonas and bactericidal against fibrinogen. Z-Phe-Lys-2,4,6-trimethylbenzoyloxy-methylketone trifluoroacetate salt also inhibits the formation of osteoclasts by inhibiting the uptake and protease activity of extracellular matrix proteins such as fibrinogen. This drug is currently being researched for possible use in the treatment of Alzheimer's Disease.Formula:C34H41N3O6Purity:Min. 95%Molecular weight:587.71 g/mol2-Fluoro-6-methylbenzoic acid
CAS:Please enquire for more information about 2-Fluoro-6-methylbenzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H7FO2Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:154.14 g/molH-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt
CAS:Please enquire for more information about H-Cys-Ser-Arg-Ala-Arg-Lys-Gln-Ala-Ala-Ser-Ile-Lys-Val-Ala-Val-Ser-Ala-Asp-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C82H149N31O26SPurity:Min. 95%Molecular weight:2,017.32 g/mol4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester
CAS:Please enquire for more information about 4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C21H33BN2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:388.31 g/molChromone-2-carboxylic acid
CAS:Chromone-2-carboxylic acid is a hydrochloric acid analog that is a prodrug for the formation of the active metabolite chromone-2,4-dihydroxybenzoic acid. Chromone-2-carboxylic acid has been shown to have anti-inflammatory properties in vitro and in vivo. It has also been shown to inhibit leukotriene synthesis by blocking the binding of LTC4 to its receptor.
Formula:C10H6O4Purity:Min. 95%Molecular weight:190.15 g/molMethoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt
CAS:Please enquire for more information about Methoxycarbonyl-D-Nle-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C22H34N8O7Purity:Min. 95%Molecular weight:522.56 g/mol(Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct
CAS:Please enquire for more information about (Des-Gly10,D-Tyr5,D-His(Bzl)6,Pro-NHEt 9)-LHRH trifluoroacetate salct including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C66H86N18O12Purity:Min. 95%Molecular weight:1,323.5 g/molH-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt
CAS:Please enquire for more information about H-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C38H61N11O9SPurity:Min. 95%Molecular weight:848.03 g/molSodium dimethyldithiocarbamate hydrate
CAS:Sodium dimethyldithiocarbamate hydrate is a salt of dimethyldithiocarbamic acid. It is used as an additive in paints and coatings to prevent corrosion of metal. Sodium dimethyldithiocarbamate hydrate is also used in the production of polyurethane and polyester resins, where it acts as a curing agent. Dimethyldithiocarbamic acid has been shown to be a ligand for the influenza virus, inhibiting viral activity by binding to the hemagglutinin protein. The crystal system of this substance is hexagonal; its salts exist in both acidic and basic forms. The functional theory explains the stabilization of this compound through coordination with nitrogen atoms on one side and phenyl substituents on the other side. Hexamethylenetetramine reacts with sodium chloride to form sodium dimethyldithiocarbamate hydrate, which can then react with methanol or eth
Formula:C3H6NNaS2·xH2OPurity:Min. 95%Color and Shape:White PowderMolecular weight:143.2 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS:Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C73H109N19O16Purity:Min. 95%Molecular weight:1,508.77 g/molC-Peptide (human) acetate salt
CAS:C-Peptide (human) acetate salt H-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala -Gly Ser Leu Gln Pro Leu Ala Leu Glu Gly Ser Leu Gln Pro Leu Ala is a peptide that has been purified from the pancreas of human and bovine sources. It is used in blood sampling and rate constant experiments to measure the response element on a signal peptide. This experiment can be used to study insulin production, as well as other biological samples. C Peptide (human) acetate salt H Glu Ala Glu Asp Leu Gln Val Gly Gln Val Glu Leu Gly Gly Gly Pro Gly Ala Gly Ser Leu Gln Pro Leu Ala has inhibitory properties againstFormula:C129H211N35O48Purity:Min. 95%Molecular weight:3,020.26 g/mol4-Chlorophenylboronic acid
CAS:4-Chlorophenylboronic acid is a chemical compound that is used in the industrial preparation of biphenyl. It is produced by the Friedel-Crafts reaction between chlorine and 4-methoxyphenylboronic acid. This reaction can be carried out using a variety of solvents, such as chloroform or carbon tetrachloride. The optimal reaction conditions are acidic pH values, which are achieved by adding sodium carbonate to the solution. The product can be purified by distillation or crystallization. 4-Chlorophenylboronic acid can also be used for the synthesis of organic compounds through cross-coupling reactions with organometallic reagents, such as palladium chloride and triphenylphosphine, or through asymmetric synthesis with chiral ligands like (S)-proline and 2-(diphenylphosphino)ferrocene.Formula:C6H6BClO2Purity:Min. 95%Color and Shape:PowderMolecular weight:156.37 g/molPACAP-27 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
CAS:Trifluoroacetate saltFormula:C142H224N40O39SPurity:Min. 95%Molecular weight:3,147.61 g/molH-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
CAS:The Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a biologically active form of arginine. It has been shown to inhibit the activity of both NS3 protease and NS4A protease from the hepatitis C virus (HCV). It also inhibits tumor cell growth in vitro, which may be due to its ability to upregulate epidermal growth factor receptor (EGFR) expression on tumor cells. The Arg-Arg-Arg-Arg-Arg-Arg-Arghydrogen trifluoroacetate salt is an inhibitor of estrogen receptor modulators that are used as therapeutic agents for breast cancer.Formula:C42H86N28O8Purity:Min. 95%Molecular weight:1,111.32 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2Formula:C221H368N72O66SPurity:Min. 95%Molecular weight:5,121.8 g/mol2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid
CAS:2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid is a fine chemical that is used in research and as a reagent. It is also used as a building block for more complex compounds and as a versatile scaffold in organic synthesis. 2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid can be reacted with other chemicals to create new compounds. This chemical has been shown to have antihistamine properties and may also function as an antipsychotic drug.Formula:C9H6BrNO5Purity:Min. 95%Molecular weight:288.05 g/mol(Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C195H300N56O56SPurity:Min. 95%Molecular weight:4,356.88 g/molSpexin trifluoroacetate salt
CAS:Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C74H114N20O19SPurity:Min. 95%Molecular weight:1,619.89 g/molN-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt
CAS:Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C70H116N26O18Purity:Min. 95%Molecular weight:1,609.83 g/mol
![4-[4-(N-Boc)piperazin-1-yl]phenylboronic acid pinacol ester](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFN162753.webp&w=3840&q=75)
![2-(4-Bromobenzo[d][1,3]dioxole-5-carboxamido)acetic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFB66447.webp&w=3840&q=75)
