Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
APLP2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through extensive research using transcription-quantitative polymerase chain and patch-clamp techniques, it has been proven to effectively inhibit bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. This drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
CD45R antibody (Spectral Red)
CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.
Purity:Min. 95%Tyrosine Hydroxylase antibody
Tyrosine hydroxylase antibody was raised in mouse using mouse monoclonal as the immunogen.
PAWR antibody
The PAWR antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It has been found to be effective in neutralizing autoantibodies, stimulating colony growth, and regulating the epidermal growth factor. Additionally, this antibody has shown promising results in inhibiting caspase-9 activity, which is essential for apoptosis.
RAF1 antibody
The RAF1 antibody is a monoclonal antibody that specifically targets elastase, an enzyme involved in the breakdown of proteins. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody can be used to detect elastase levels in various biological samples, including human serum. Additionally, it has been shown to have potential therapeutic applications, such as inhibiting the action of elastase in conditions like pancreatitis or chronic obstructive pulmonary disease (COPD). The RAF1 antibody can also be used in combination with other antibodies, such as insulin or anti-VEGF antibodies, to study the interactions between different growth factors and signaling pathways. Its versatility and specificity make it a valuable tool for scientists and researchers working in diverse areas of biomedical research.
Purity:Min. 95%Complement C5 antibody
Complement C5 antibody was raised in mouse using human complement component C5 as the immunogen.
GALNT2 antibody
The GALNT2 antibody is a monoclonal antibody that targets the GALNT2 protein. This antibody is commonly used in life sciences research, particularly in the study of growth factors and tyrosine kinase receptors. It can be used in immunoassays to detect and quantify GALNT2 levels in various biological samples.
CHCHD6 antibody
CHCHD6 antibody was raised in rabbit using the middle region of CHCHD6 as the immunogen
TMCC1 antibody
TMCC1 antibody was raised using the middle region of TMCC1 corresponding to a region with amino acids YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK
Purity:Min. 95%BRM antibody
The BRM antibody is a monoclonal antibody used in Life Sciences for its antiviral properties. It is an inhibitor that targets specific virus surface antigens, preventing their interaction with host cells and inhibiting viral replication. This antibody has shown high efficacy against a wide range of viruses, including those causing respiratory infections, influenza, and herpes.
