Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Neu antibody
Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.
Phosphotyrosine antibody
The Phosphotyrosine antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically recognize and bind to phosphorylated tyrosine residues on proteins, making it an essential tool for studying kinase substrates and phosphatase activity. This antibody is particularly useful in investigating signaling pathways involving tyrosine kinase receptors, such as the epidermal growth factor receptor or colony-stimulating factor receptor.
Purity:Min. 95%ATG5 antibody
ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTDPurity:Min. 95%LDB1 antibody
The LDB1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets the LDB1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in applications such as immunohistochemistry, Western blotting, and flow cytometry.
AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.CD4 antibody (Allophycocyanin-CY7)
CD4 antibody (Allophycocyanin) was raised in mouse using human CD4 as the immunoge.
Purity:Min. 95%CDKL3 antibody
The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.
CD62L antibody
The CD62L antibody is a monoclonal antibody that has neutralizing properties against interferon (IFN) and endothelial growth factor. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets CD62L, a cell surface protein involved in leukocyte adhesion and migration. By binding to CD62L, the antibody inhibits the interaction between leukocytes and endothelial cells, thereby reducing inflammation and immune response. Additionally, this antibody has been pegylated to improve its stability and prolong its half-life in circulation. The CD62L antibody is widely utilized in studies related to autoimmunity, cancer, and inflammatory diseases. Its high specificity and efficacy make it an invaluable tool for researchers in various fields.
HIV1 gp41 antibody (biotin)
HIV1 gp41 antibody (biotin) was raised in goat using recombinant ectodomain of gp41 (glycosylated) as the immunogen.ADRB3 antibody
The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.
SLC26A10 antibody
SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen
Purity:Min. 95%
