Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
NSUN2 antibody
NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP
CBS antibody
The CBS antibody is an endogenous hematopoietic monoclonal antibody that plays a crucial role in various Life Sciences applications. It is commonly used as a nuclear marker and can be utilized in experiments involving electrodes. The CBS antibody is highly specific and exhibits strong binding affinity to its target, making it an ideal tool for research purposes. Additionally, this antibody has been shown to have inhibitory effects on fatty acid metabolism and can serve as a valuable tool for studying the role of fatty acids in cellular processes. Antibodies against CBS are also used in diagnostic assays to detect autoantibodies in human serum samples. Furthermore, the CBS antibody has demonstrated anti-angiogenesis properties, making it a potential therapeutic candidate for conditions characterized by abnormal blood vessel growth. In summary, the CBS antibody is a versatile and valuable tool in the field of Life Sciences with diverse applications ranging from research to diagnostics and therapeutics.
SAMHD1 antibody
The SAMHD1 antibody is a highly specialized monoclonal antibody that specifically targets the SAMHD1 protein. This protein plays a crucial role in regulating the cellular dNTP pool, which is essential for DNA replication and repair. By binding to SAMHD1, this antibody can effectively inhibit its function and disrupt the normal cell cycle.
CKS2 antibody
The CKS2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the toxic effects of colony-stimulating factors, which are proteins that regulate the production and differentiation of white blood cells. The CKS2 antibody specifically targets the phosphatase activity of colony-stimulating factors, inhibiting their ability to stimulate cell growth and division.
FAM135B antibody
FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
HECTD2 antibody
HECTD2 antibody was raised using the C terminal of HECTD2 corresponding to a region with amino acids TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET
p27Kip1 antibody
The p27Kip1 antibody is a highly specialized tool used in the field of Life Sciences. It is an activated electrode that specifically targets and binds to p27Kip1, a protein involved in cell cycle regulation. This monoclonal antibody is designed to recognize and bind to p27Kip1 with high affinity and specificity, making it an essential tool for researchers studying cellular processes.
