Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
PDIA4 antibody
PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL
Purity:Min. 95%Rabbit anti Mouse IgM
Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific
Purity:Min. 95%TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Purity:Min. 95%Rabbit anti Dog IgG (HRP)
Rabbit anti-dog IgG (HRP) was raised in rabbit using canine IgG F(ab')2 fragment as the immunogen.Purity:Min. 95%AVPV2 antibody
AVPV2 antibody was raised in rabbit using 21aa peptide of rat AVPV2 receptor. as the immunogen.Purity:Min. 95%TCF25 antibody
TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen
Purity:Min. 95%CD11c antibody (FITC)
CD11c antibody (FITC) was raised in Mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.
Purity:Min. 95%GNAI1 antibody
GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
PAK1 antibody
The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.
Purity:Min. 95%CD38 antibody
The CD38 antibody is a highly specialized monoclonal antibody that binds to CD38, a protein found on the surface of certain cells. This antibody has cytotoxic properties and can be used in various applications, including research and diagnostics. It specifically targets CD38-expressing cells and can be used to study their function or as a therapeutic agent.
KRT14 antibody
KRT14 antibody was raised in rabbit using the C terminal of KRT14 as the immunogen
Purity:Min. 95%Hepatitis B Virus preS1 antibody
Hepatitis B Virus preS1 antibody was raised in mouse using hepatitis B virus as the immunogen.
