Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Moesin antibody
Moesin antibody is an endogenous hematopoietic monoclonal antibody that has anticoagulant properties. It binds to fatty acids and other molecules, inhibiting their activity in the blood. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) activity, which can help prevent the formation of new blood vessels and inhibit tumor growth. Moesin antibody is activated at acidic pH levels and can effectively neutralize insulin antibodies in human serum. Additionally, this antibody has been used as a growth factor in cell culture experiments due to its ability to promote cell proliferation and survival.PRMT5 antibody
The PRMT5 antibody is a highly effective inhibitor that specifically targets protein kinase activity. This monoclonal antibody has been extensively tested and validated by Life Sciences experts to ensure its efficacy. It can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.
p27Kip1 antibody
The p27Kip1 antibody is a highly specialized tool used in the field of Life Sciences. It is an activated electrode that specifically targets and binds to p27Kip1, a protein involved in cell cycle regulation. This monoclonal antibody is designed to recognize and bind to p27Kip1 with high affinity and specificity, making it an essential tool for researchers studying cellular processes.
STAC3 antibody
The STAC3 antibody is a recombinant antigen that has shown potential in the treatment of non-alcoholic steatohepatitis (NASH). This effective substance belongs to the class of antibodies, which are proteins that can specifically bind to certain molecules in the body. The STAC3 antibody has been tested as a test substance for its ability to inhibit protein kinase activity, an enzyme involved in various cellular processes. Inhibitors of protein kinases have been studied extensively in Life Sciences for their potential therapeutic applications.
RAB39A antibody
The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.
LZTFL1 antibody
LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.TRMT5 antibody
TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT
C17ORF39 antibody
C17ORF39 antibody was raised using the C terminal Of C17Orf39 corresponding to a region with amino acids SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
Clostridium difficile Toxin A antibody
The Clostridium difficile Toxin A antibody is a monoclonal antibody that specifically targets the toxin produced by Clostridium difficile bacteria. This antibody is derived from human proteins and contains specific amino acid residues that have been activated to enhance its binding affinity. It works by neutralizing the effects of the toxin, which includes damaging the intestinal lining and causing inflammation.
