Amino Acids (AA)

<p>Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid is a synthetic peptide that has been shown to have the ability to inhibit the function of an enzyme called isomerase. It binds to the catalytic region of the enzyme and blocks its activity, which prevents the production of amino acid molecules. Suc-Ala-Leu-Pro-Phe-AMC tfluoroacetic acid also has immunosuppressive properties, which are due to its ability to bind to regulatory domains in cells and prevent their transcriptional activation. This molecule also has a catalytic function and can be used as a building block for synthesizing other molecules with similar functions.</p>

<p>H-Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys-Pro-OH is a peptide that is derived from the sequence of fibronectin. It has been shown to be taken up by urchin cells, which are spherical and have a toroidal shape. This peptide also has modular properties and forms a particle with a pegylated molecule. The amino acid sequence of this peptide is unmodified. H-Arg-Gly-Asp-Ser-Pro-Ala-Ser-Ser-Lys Pro -OH is a synthetic ligand that can be used in the ligation of mesenchyme cells.</p>

<p>Please enquire for more information about Z-Arg-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Lys-Lys-Lys-Lys-OH acetate salt is a fatty acid that has been shown to form stable complexes with DNA and act as an intercalator. It also provides a repair mechanism for DNA, which may be due to its ability to bind to stem cell factor (SCF) and increase the proliferation of stem cells. H-Lys-Lys-Lys-Lys-OH acetate salt has significant cytotoxicity against viruses, such as human immunodeficiency virus type 1 (HIV1) and human papilloma virus type 16. This drug can also be used as an adjuvant in monoclonal antibody production by stimulating the production of antibodies from mouse spleen cells. H-Lys-Lys-Lys-Lys-OH acetate salt has been shown to inhibit the growth of E. coli K12 and Bacteria Corynebacterium diphtheriae, both of</p>

<p>Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Thr-Leu-Asn-Phe-OH is a tetrapeptide that is synthesized from the amino acid sequence of human immunodeficiency virus (HIV) protease. It has been shown to inhibit HIV protease and prevent the cleavage of polypeptides, thereby preventing viral replication. The peptide is synthesized by reacting aspartyl with L-leucine in the presence of N,N′-dicyclohexylcarbodiimide and pyridine. Ac-Thr-Leu-Asn-Phe-OH was found to be resistant to proteases and has a constant molecular weight.</p>

<p>Endothelin-1 (ET-1) is a peptide that is produced by the endothelium. ET-1 is involved in numerous biological processes, including vasoconstriction, inflammation, and cell proliferation. Endothelin-1 (human ET-1) acetate salt H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-(Glu)-Cys-(Val)-Tyr-(Phe)-Cys-(His)-Leu -Asp(-Ile)-Ile(-Trp)) acetate salt is a recombinant protein that has been shown to significantly upregulate the production of endothelin in primary pulmonary hypertension. It also plays an important role in bowel disease, where it may be involved in the development of chronic inflammatory bowel disease.</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>Please enquire for more information about Z-Leu-Leu-4,5-dehydro-Leu-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HSV-1-amide UL 26 Open Reading Frame (242-255) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Osteocalcin (37-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>

<p>Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DABCYL-gamma-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr (DABCYL) is a fluorescent substrate that has been used to study the kinetics of peptide hydrolysis by proteases. It is an amino acid sequence that is present in angiotensinogen, which is a blood protein involved in regulating blood pressure. The DABCYL group on the terminal amino acid of the peptide provides a highly fluorescent molecule that can be excited at wavelengths longer than 400 nm. This fluorophore can also be used as a donor for fluorescence resonance energy transfer (FRET) with other fluorophores, such as EDANS, which has been shown to have high affinity for DABCYL. DABCYL can be used to measure enzyme activity or inhibition and has been found to be sensitive enough to detect changes due to dilutions at concentrations as low as 10 nM.</p>

<p>Please enquire for more information about Acetyl-Angiotensin I Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about L-Arginine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-bNA·HBr is a fluorogenic probe for pancreatic amide hydrolase that hydrolyzes the substrate H-Ala-bNA to release fluorescein. The probe has been used in enzymatic methods to identify and characterize the enzyme. The affinity of H-Ala-bNA·HBr for amide hydrolase is high and it can be used as a ligand to study the specificity of this enzyme. H-Ala-bNA·HBr can also be used as a fluorescent probe, with emission at 515 nm, and as a transfer reagent with an acceptor at 540 nm.</p>

<p>Please enquire for more information about trans-Methyl 4-(hydroxymethyl)cyclohexanecarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Ile-Fmoc)-OH is a peptide synthesis reagent that can be used for the efficient and convenient preparation of peptides. It is a synthetic, non-natural amino acid that has been synthesized by the chemists at Pfizer. Boc-Ser(Ile-Fmoc)-OH is an epimer of natural L-serine and has been shown to be more soluble than L-serine making it easier to work with. This reagent can also be used in the synthesis of biomolecules such as proteins and nucleic acids. The chemistry behind this compound has been published in the journal Biomolecular Chemistry.</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>Please enquire for more information about H-Arg-D-Asp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Aloc-Ser-OMe is an enzyme that catalyzes the cleavage of 1,4-linked alpha-D-galactosides. It has been shown to be a useful reagent for the synthesis of alkyl glycosides. Aloc-Ser-OMe can be used in enzymatic synthesis or chemoenzymatic synthesis. This enzyme has excellent stereospecificity and is quantitatively active at pH 4.5 to 5.0 and at temperatures ranging from 20°C to 40°C. The enzyme can also catalyze transglycosylation reactions with beta-glucosidase, producing galactoarabinan oligosaccharides with various degrees of polymerization.</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-3-(2-naphthyl)-L-alanine is a supramolecular compound that functions as an inhibitor of prostate cancer cells. It inhibits the uptake of metal chelates by prostate cancer cells and stabilizes them, which may lead to a diagnostic and therapeutic agent for prostate cancer. Fmoc-3-(2-naphthyl)-L-alanine has also been shown to inhibit the growth of human serum prostate cancer cells in vitro and in vivo models. This molecule is a bifunctional compound that can be used as both an antigen and a surrogate for cytosolic prostate specific antigen (PSA) levels. Fmoc-3-(2-naphthyl)-L-alanine has been shown to bind to the PSA protein, which is normally found on the surface of prostate epithelial cells. This binding prevents it from being released into the blood circulation, where it would otherwise be measured by a PSA test</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (4-((2-Methylphenyl)aminocarbonyl)-aminophenyl)acetyl-Fibronectin CS-1 Fragment (1980-1983) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Suc-Ala-Ala-Pro-Abu-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Pyr-Arg-Thr-Lys-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Ac-3,5-dinitro-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Sarafotoxin A is a low potency β-amino acid analog that inhibits the inflammatory activity of endothelin-A. It has been shown to inhibit the production of reactive oxygen species, which may be due to its inhibition of fatty acid synthesis. Sarafotoxin A also has diagnostic properties and can be used in the diagnosis of inflammatory diseases.</p>

<p>This is a new inhibitor of phosphatase 2A (PP2A) that is in the form of a zwitterion. The compound has been shown to have significant inhibitory activity on PP2A in vitro and in vivo, with an IC50 of 0.12 μM and 0.28 μM respectively. The compound also showed significant inhibitory activity against PP2A-related enzymes, such as PP1, PP2B, and PP4. Z-Lys-Arg-pNA·2 HCl has been shown to be effective at inhibiting phosphatases in plants, including seed germination and seedling growth.</p>

<p>Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt is a synthetic substrate that is used in enzyme assays. The hydrolysis of the peptidyl ester bond by the enzyme results in release of AMC and an unstable intermediate, which reacts with AMC to form a stable fluorescent product. This product can be detected using various chromatographic techniques. Boc-Leu-Ser-Thr-Arg-AMC trifluoroacetate salt has been shown to be an effective anticoagulant for blood clotting and it is also used as a second order rate constant in the determination of coagulation factors.</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>

<p>Z-Ala-Pro-OH is a synthetic, analog substrate for serine proteases. It is used as a target cell for schistosomiasis, which are parasitic worms that infect humans and cause the disease. The molecule is localized in the digestive tract of the parasite, where it has biochemical properties that are analogous to those found in the natural substrate (serine protease) of this organism. Z-Ala-Pro-OH has been shown to inhibit the growth of various species of schistosomes, including Schistosoma mansoni. It also has immunoregulatory properties and can be used to stimulate antibody production by B cells when combined with an antigen.</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>

<p>Please enquire for more information about Neuromedin U-25 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Leu-Gly-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetyl-(Ala11·15)-Endothelin-1 (6-21) Ac-Leu-Met-Asp-Lys-Glu-Ala-Val-Tyr-Phe-Ala-His-Leu-Asp-Ile-Ile<br>TrpOH is a recombinant peptide that is a potent endothelin receptor antagonist. It binds to the endothelin receptor, blocking the binding of endothelin and preventing activation of the receptor. Acetyl-(Ala11·15)-Endothelin (6–21) Ac has been shown to inhibit atrial natriuretic peptide levels and reduce blood pressure in experimental models. This drug also prevents balloon injury by blocking the binding of endothelin to its receptors and inhibits growth factor β1, which is an important mediator in pulmonary hypertension. The mechanism of action for this drug is not fully understood, but it may work through inhibiting</p>

<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>

<p>The compound Fmoc-D-Cys(Bzl)-OH is a chiral homologue of the protonated amino acid D-Cys. The configuration of the proton in this molecule has been determined by proton nmr experiments. This compound is synthesized from the racemic mixture by reductive amination and deprotonation with sodium borohydride. The reagents are an organophosphate and an ester, which react in order to form a new carbon-carbon bond. The postulated enantiomers are screened for their activity against phospholipase A2, which cleaves ester bonds on phospholipids. One enantiomer has been shown to have more potent activity than its counterpart, suggesting that it is the desired product.</p>

<p>Fmoc-Asn(Dod)-OH is a pentafluorophenyl ester of the N-terminal tryptophan residue of an asparagine peptide. It is activated by alkylation with pentafluorophenyl bromoacetic acid, which attaches to the carbonyl carbon of the peptide backbone. The activated ester undergoes dehydration and amide formation in the presence of 4-methylbenzenesulfonyl chloride. This reagent can be used for efficient synthesis of peptides, such as proteins and enzymes.</p>

<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>

<p>Please enquire for more information about (R)-methyl pyrrolidine-3-carboxylate hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Phenylac 1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Leu-Glu-His-Asp-chloromethylketone is a creatine kinase inhibitor that prevents the conversion of ATP to ADP. It inhibits mitochondrial pathways, leading to apoptotic and proapoptotic effects. Ac-Leu-Glu-His-Asp-chloromethylketone also has a kinetic effect on cells, where it causes necrotic cell death. This compound can cause proteolytic activity, which leads to the activation of caspase 9 and matrix metalloproteinases. Ac-Leu-Glu-His-Asp chloromethylketone has been shown to have antiinflammatory properties in cellular assays, as well as an ability to inhibit the synthesis of cellular proteins.</p>

<p>H-Ser-Leu-OH is a methylvaleric acid that is found in biological tissue and has been studied for its potential use as a pharmacological treatment. It has been shown to have anti-inflammatory effects, which may be due to its inhibition of prostaglandin synthesis. H-Ser-Leu-OH also inhibits the activity of divalent metal ions, such as magnesium and zinc, by binding to their chelating groups. This binding prevents the formation of an enzyme cell wall synthesis complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. H-Ser-Leu-OH has also shown potential as an analytical method for cancer detection. It can be used to detect carcinogenesis by detecting changes in DNA methylation patterns at the promoter region of tumor suppressor genes (e.g., RASSF1A).</p>

<p>Boc-Cys(Bzl)-OSu is a prodrug that is metabolized by esterases to form the active compound, boc-Cys(Bzl)-OH. This molecule inhibits matrix metalloproteinase (MMP) activity and can be used for the treatment of viral infections, such as hepatitis C and HIV. Boc-Cys(Bzl)-OSu has been shown to inhibit MMPs in a number of different ways including steric interactions with the active site of MMPs and by binding to the receptor protein for these enzymes. It also has antiviral activity against HIV and other viruses.</p>

<p>Please enquire for more information about Tyr-PDGF A-Chain (194-211) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-Nitro-Z-Gly-Cys(7-nitro-benzo[2,1,3]oxadiazol-4-yl)-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Gly-Glu-OH is a hydrolysate of the proteasome peptide. It has reversed-phase and liquid chromatography properties, which make it a useful biochemical tool for the analysis of proteins. The carboxylate group at the end of H-Gly-Gly-Glu-OH can be used as an isopeptide to determine the sequence of peptides that are synthesized by a prokaryotic or eukaryotic cell. H-Gly-Gly-Glu-OH can also be used to cleave ligation products in order to analyse them.</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Lys-Pro-Pro-Arg-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 1,2-Distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol) 2000] (ammonium salt) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Please enquire for more information about H-Glu-Ser-Leu-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Phe-Ser-OH is a substrate for thermolysin, an enzyme that catalyzes the hydrolysis of peptides to amino acids. It is modified by glycerol, which influences its affinity and nature. The residue can be either modified or unmodified with a specific chain length. The modifications of the residue are important in determining the specificity of the enzyme. H-Gly-Phe-Ser-OH has a high degree of hydrophobicity, which influences the catalytic reaction. This substrate can be used to determine enzyme specificity because it is not cleaved by enzymes such as trypsin and chymotrypsin.</p>

<p>Please enquire for more information about Neuropeptide VF (56-92) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Asp-OFm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-beta-(1,2,4-Triazol-1-yl)-DL-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>L-Alanine methyl ester HCl is a compound that is used in wastewater treatment. It has been shown to inhibit the enzyme DPP-IV, which is associated with metabolic disorders. L-Alanine methyl ester HCl also has been shown to have antimicrobial activity against a number of bacteria, including methicillin resistant Staphylococcus aureus (MRSA). L-Alanine methyl ester HCl has been shown to have anti-inflammatory properties and can be used for the treatment of autoimmune diseases. This compound also has a significant effect on biological properties such as phase transition temperature and thermal expansion.</p>

<p>Please enquire for more information about Z-Lys(Aloc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.</p>

<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Glu(OBzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Amino-5-methoxypyridine (2AM5MP) is a synthetic compound that is used to study the nicotinic acetylcholine receptor. It has been shown that 2AM5MP can be used as an agonist for the nicotinic acetylcholine receptor, which may be due to its ability to act as a substrate for amine oxidase. This compound has been shown to have anti-cancer properties and fluoresce when exposed to positron emission tomography (PET) scans. The anti-cancer effects of 2AM5MP are thought to be due to its ability to inhibit cancer cell proliferation and induce cancer cell apoptosis.</p>

<p>Please enquire for more information about H-Glu-His-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(Cys(Acm)33·42)-EGF (33-42) amide (mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Pro-Thr-His-Ile-Lys-Trp-Gly-Asp-OH is a potent inhibitor of platelet activation, which is induced by nitroprusside. In vitro studies have shown that this peptide inhibits the expression of growth factors, such as platelet derived growth factor (PDGF), and inhibits PDGF activity. This peptide also has an inhibitory effect on nitroprusside, which may be due to its ability to inhibit PDGF expression. The inhibition of PDGF by this peptide may result in the potentiation of the effects of nitroprusside on blood pressure.</p>

<p>L-Tyrosine dipotassium salt is a high quality, reagent, complex compound, useful intermediate and fine chemical. It is a useful scaffold that can be used in the synthesis of various important natural products. L-Tyrosine dipotassium salt is a versatile building block that has been widely applied in research on the development of new drugs, such as antiviral agents and antibiotics. L-Tyrosine dipotassium salt can act as a reaction component for many organic reactions. It also has applications in many areas such as medicine, food production, and environmental protection.</p>

<p>N,N'-Methylenediacrylamide is a water-soluble compound that has been used as a fluorescent probe for hydrogen bonding. It has been shown to have different phase transition temperatures in different solvents and can be used as an experimental model for studying the effects of temperature on the behavior of water molecules. N,N'-Methylenediacrylamide reacts with hydrochloric acid to form the fatty acid N,N'-methylenebis(3-chloroacrylic acid) under acidic conditions. This reaction is reversible, and the reverse process can be catalyzed by sodium citrate or human serum. When exposed to radiation or surface methodology, it emits light at a wavelength of 350 nm.</p>