Amino Acids (AA)

<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Antho-RFamide Pyr-Gly-Arg-Phe-NH2 is an acidic amino acid. It has been shown to be a precursor of dopamine β-hydroxylase, which is a key enzyme in the synthesis of epinephrine and norepinephrine. This compound has a diameter of 0.8 nm, and it's been observed in cnidarians and multicellular animals. The biological function of Antho-RFamide Pyr-Gly-Arg-Phe-NH2 is not yet known, but it has been sequenced and identified as fatty acid with a sequence that is identical to serotonin. Analysis shows that this molecule contains an acidic environment with an alkaline pH.</p>

<p>Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 is a synthetic peptide that was designed to mimic the sequence of muramyl dipeptide (MDP), which is found in bacterial cell walls. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 binds to the protein albumin, which is an important component of human blood plasma and has been shown to be elevated in patients with autoimmune diseases. This peptide also inhibits the activity of metal hydroxides, such as aluminum hydroxide and calcium hydroxide, by binding to their surface, reducing their antimicrobial activity. The effect on locomotor activity has not been studied. Ac-muramyl-Ala-D-Glu(Lys(stearoyl)-OH)-NH2 may have effects on various cells types including macrophages and T</p>

<p>Please enquire for more information about Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The melanocortin-4 receptor (MC4R) is a G protein-coupled receptor that mediates the protective and cytoprotective activities of endogenous melanocortins. This receptor has been shown to be an important target for neuroprotective agents. The MC4R is expressed in the central nervous system, peripheral nervous system, and other tissues where it may have a role in regulating energy homeostasis. The N-terminal amino acid sequence of the human MC4R ligand is H-His-Phe-Arg-Trp-OH. This peptide has been shown to have potent agonist potency at the MC4R with a Kd of 0.2 nM and an EC50 of 2 nM.</p>

<p>Polymyxin B is a cationic detergent that binds to bacterial membranes and destroys the cell wall. Polymyxin B has been shown to be a potent antagonist of spermatozoa and microglia, which are cells that maintain the homeostasis of the central nervous system. It also has been shown to be an inhibitor of chemotaxis in polymorphonuclear leucocytes (PMN), which are white blood cells that participate in inflammatory processes. Polymyxin B has been shown to have chemotactic activity for PMN and inhibit protein synthesis in mitochondria. This compound also inhibits chelerythrine, a cyclase inhibitor that is used as an antineoplastic agent.</p>

<p>Please enquire for more information about ([13C6]Leu15)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HIV is a type of virus that causes AIDS. HIV infects the cells of the human immune system, destroying them and making the body vulnerable to infections from other types of viruses and bacteria. The gp120 protein is an envelope glycoprotein that mediates binding to the CD4 receptor on host T-helper cells and induces fusion of viral and cellular membranes. The gp120 protein has been studied using a variety of methods, including neutralizing antibody binding experiments, enzyme-linked immunosorbent assays (ELISA), Western blotting, peptide mapping, and density lipoprotein binding assays. This fragment contains residues 308-331 in a human immunodeficiency virus (HIV) type 1 gp120 protein.</p>

<p>Please enquire for more information about Fmoc-Leu-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>Please enquire for more information about IL-6 (88-121) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Leu-Fmoc)-OH is a peptide that has been synthesized using the Fmoc strategy. The peptide has been synthesized in an efficient manner and it is an epimer of Boc-Ser(Leu-OH).</p>

<p>Please enquire for more information about Biotinyl-Angiotensin I/II (1-7) Biotinyl-Asp-Arg-Val-Tyr-Ile-His-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about AMCA-Glu-Glu-Lys-Pro-Ile-Ser-Phe-Phe-Arg-Leu-Gly-Lys(biotinyl)-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>DL-Alanine ethyl ester hydrochloride is a byproduct of the reaction between ethylene and amines. It can be produced through the addition of l-phenylalanine to acetonitrile. This compound is an organic ester that has been shown to have a variety of reactions with metal ions, such as aluminium, l-glutamic acid, and primary amines. The product can be used in thermodynamic data for reaction systems involving DL-alanine ethyl ester hydrochloride.</p>

<p>Tau-fluvalinate is a pesticide that is used to control ectoparasites. It has been shown to be effective against fleas, ticks, and mites. Tau-fluvalinate binds to the active site of the enzyme protein kinase C (PKC). This binding prevents the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3), which is required for cell signaling pathways and protein synthesis. Tau-fluvalinate also inhibits detoxification enzymes such as glutathione S-transferase (GST) and cytochrome P450 reductase. Tau-fluvalinate has been shown to have no sublethal effects on insects in vitro or in vivo at doses below its LD50. Tau-fluvalinate can also be used as an analytical standard for detecting polycyclic aromatic hydrocarbons in water samples with chemical ionization gas chromatography.</p>

<p>Please enquire for more information about Tos-Gly-Pro-Arg-AMC·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Tyr-Val-Ala-Asp-chloromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gly-Pen-Gly-Arg-Gly-Asp-Ser-Pro-Cys (GPEG) is a peptide that modulates the function of muscle cells and is present in collagen. GPEG has been shown to improve oxidative damage, which occurs during exercise. The effect of GPEG on muscle cells is dependent on the dose. Low doses of GPEG activate proteins that are involved in transcription and increases the synthesis of oxidative enzymes, while high doses inhibit these proteins. GPEG also modulates integrin receptor expression and decreases fibronectin production by vascular smooth muscle cells.</p>

<p>4-Methylsalicylamide is a chemical compound that belongs to the class of isonicotinic amides. It is a potent anti-inflammatory agent with minimal inhibitory concentration (MIC) values of 4 µg/mL for gram-positive bacteria and 8 µg/mL for gram-negative bacteria. This compound has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, although is not active against acid-fast bacteria such as Mycobacterium tuberculosis or Mycobacterium avium complex. 4-Methylsalicylamide has been shown to have an inhibitory effect on ring-opening, which may be due to its ability to acetylate mitochondrial membranes, altering the membrane potential. The molecular modeling studies also showed that 4MSAM binds at the same site as antibiotics such as penicillin and erythromycin in bacterial ribos</p>

<p>(Des-Gly10, tBu-D-Gly6,Pro-NHEt 9)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-Arg-Pro-NHEt trifluoroacetate salt is a synthetic hormone that is the active form of luteinizing hormone releasing hormone (LHRH), a gonadotropin releasing hormone (GnRH). It has been used in the diagnosis and treatment of prostate cancer. The drug is also used to treat endometriosis and other conditions. It can be administered by injection or as an intranasal spray. The drug inhibits follicular growth and fertility by downregulating estradiol benzoate production.</p>

<p>Please enquire for more information about Ac-Pro-Leu-Gly-[(S)-2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OEt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>CRF (6-33) is a neuropeptide that is found in the human cerebral cortex and rat liver. It has been shown to inhibit protein synthesis and sequenced by Edmond H. Fischer, who also discovered corticotropin-releasing factor (CRF). CRF (6-33) binds to its receptor CRFR1, which activates phospholipase C and generates inositol 1,4,5-triphosphate. This leads to the release of calcium from intracellular stores and the activation of protein kinase C. The release of calcium ions into the cytosol causes an increase in intracellular levels of cAMP, which activates a series of reactions responsible for the cellular effects of CRF. CRF (6-33) has been shown to be involved in depression by controlling neurotransmitter levels.br&gt;</p>

<p>Met-enkephalin is a 5-hydroxytryptamine (serotonin) agonist. It has been shown to have anesthetic properties and to be active in cardiac, pulmonary, and renal functions. Met-enkephalin has also been found to have a delta-opioid receptor activity. This molecule has been shown to inhibit noradrenaline release from the locus coeruleus, as well as immunohistochemically demonstrating its presence at the atrium of the heart. Met-enkephalin also exhibits hydroxylase activity and has been shown to inhibit dopamine release from the substantia nigra pars compacta and sinoatrial node in rats. This drug can be used for treatment of pain, hypertension, angina pectoris, myocardial infarction, unstable angina, cardiogenic shock, congestive heart failure due to left ventricular dysfunction or ischemia of the coronary artery, acute pulmonary edema</p>

<p>BAM-3200 is a small molecule with the chemical formula CHFOC(O)NHCHCOOH. It is a potent and selective agonist of the TrkB receptor, which binds to brain-derived neurotrophic factor (BDNF). BAM-3200 has been shown to have anti-cancer activity in mouse tumor models, as well as increased locomotor activity and improved memory retention in mice. The biological function of BAM-3200 is not yet known. Structural analysis shows that it binds to the hydroxyl group on mammalian tissue receptors, which may be due to its basic protein structure. BAM-3200 also has been shown to hydrolyze enzymes such as esterases, glucuronidases, or glutathione reductase. This agent has been shown to be selectively active against cancer cells by binding to their acidic surface structures and altering their acidity.</p>

<p>Please enquire for more information about H-D-Pro-Pro-Glu-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Ala-Lys-OH hydrochloride salt is a tripeptide with a reactive side chain. The protonated form of the molecule can be analyzed by acid analysis, and the ligand can be synthesized in a laboratory. Amino acid analysis has shown that this tripeptide contains lysine residues, which are important for binding to the peptide transporter. This compound is taken up through the intestine and is found in porcine tissue. H-Ala-Ala-Lys-OH hydrochloride salt has been used as a model compound in structural studies of peptide transporters.</p>

<p>Please enquire for more information about For-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3,5-Dibromo-Tyr1)-Leu-Enkephalin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Ala-Pro-OH is a peroxide that can be used as a radical initiator for the synthesis of polymers, such as polypropylene. It has been shown to catalyze the oxidation of hydrogen peroxide by a phenoxy group to form radicals. The rate of formation of these radicals is highly dependent on the number and location of proline residues in the molecule. Fmoc-Ala-Pro-OH is chemically stable and does not react with oxygen or light.</p>

<p>H-Thr-Arg-OH sulfate salt is a molecule that contains the active amino acid residues of vasoactive intestinal peptide (VIP) and reversed-phase high-performance liquid chromatography. The structure of VIP was determined by stepwise synthesis and chloromethyl ketone activation. It has been shown to have an intestinal effect, which is due to its ability to increase blood pressure. This drug also has potential as a therapeutic agent in the treatment of hypertension, heart disease, or diabetes mellitus.</p>

<p>Please enquire for more information about ACTH (1-39) (guinea pig) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Phe-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-O-(cis-9-Octadecenyl)-2-O-acetyl-sn-glycero-3-phosphocholine (Biotinylated BSA) is a categorized lipid that contains both carbohydrates and lipids. It is used to inseminate dairy cattle, but also has potential as a biomarker for fertility and metabolic diseases. Biotinylated BSA contains conjugates of fatty acids, which are important compounds in metabolism. The metabolome of biotinylated BSA includes nucleotides, carboxylic acids, and purines.</p>

<p>2-Methoxy estrone is a metabolite of estrone and is produced by the enzyme 2-hydroxylase. This compound has minimal toxicity and can be used as a marker for biological processes, such as cellular transformation. 2-Methoxy estrone has been shown to inhibit the activity of acetylcholinesterase, an enzyme that breaks down acetylcholine, which is essential for neurotransmission. It has also been implicated in the regulation of angiogenic processes in vitro and in vivo. The role of 2-methoxy estrone in cancer cells is not fully understood but it may have potential as a biomarker for prostate cancer and breast cancer.</p>

<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>

<p>Please enquire for more information about Acetyl-Heme-Binding Protein 1 (1-21) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Ala-Ala-Pro-OH is a building block that is used in organic synthesis as a reaction component or reagent. It can be used to synthesize a wide range of complex compounds with speciality chemical and fine chemical applications. Fmoc-Ala-Ala-Pro-OH is also a versatile building block that can be used to synthesize various useful scaffolds, such as the Fmoc amino acid sequence, which has been shown to bind heparin. This compound has high purity and can be used in research and development.</p>

<p>Please enquire for more information about Fmoc-Pro-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about PAR-2 (1-6) amide (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.</p>

<p>Suc-Ala-Ala-Val-pNA (Suc-AAV-pNA) is a specific substrate for human and rat neutrophil elastases.</p>

<p>Syntide 2 is a diacylglycerol, which has been found to have a number of biochemical properties. It is an activator of protein kinase C and has been shown to be reactive in vitro assays. Syntide 2 has also been found to activate the light chain kinase in plant physiology. This compound has also been shown to promote neuronal death and may have a role in transcriptional regulation. Syntide 2 is used as a model system for studying the physiological function of α subunit-containing proteins.</p>

<p>Please enquire for more information about H-Glu-Thr-Tyr-Ser-Lys-OH·2 TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of lenvatinib</p>

<p>4-Bromo-2-fluoro-N-methylbenzamide is an impurity in the pharmaceutical drug nilutamide. It is a ligand that binds to the androgen receptor and inhibits the binding of dihydrotestosterone, reducing its effect on prostate cells. 4-Bromo-2-fluoro-N-methylbenzamide has been shown to have pharmacokinetic properties similar to nilutamide, which is a drug used for treating prostate cancer. This impurity is also found in small quantities in other drugs including cyclobutanone, 2-aminoisobutyric acid, and chloral hydrate. The elucidation of these impurities can help regulate the quality of pharmaceutical drugs.</p>

<p>Please enquire for more information about Fmoc-His-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Naltrexone is a drug that is used in the treatment of addiction to opioids and alcohol. It has been shown to inhibit the breakdown of endorphins, which leads to reduced pain sensitivity. Naltrexone also has anti-inflammatory properties, which may be due to its inhibition of prostaglandin synthesis. Naltrexone binds to opioid receptors and blocks their action, preventing the transmission of signals by the neurotransmitter dopamine. This binding prevents the euphoric effects associated with opioid abuse while still allowing pain relief. The use of naltrexone in inflammatory bowel disease was first proposed in 1978 based on its ability to reduce colonic motility in animal models and its subsequent effect on gut function.</p>

<p>Please enquire for more information about Fmoc-D-Cys(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cecropin A is an antimicrobial peptide, which is derived from the immune systems of insects, specifically moths. It displays potent antimicrobial properties through its ability to disrupt bacterial cell membranes, leading to cell lysis and death. This peptide primarily targets Gram-negative bacteria but is also effective against some Gram-positive strains. Cecropin A has garnered significant scientific interest due to its potential applications in developing new antimicrobial agents, particularly in the face of increasing antibiotic resistance. By integrating Cecropin A into therapeutic strategies, researchers aim to broaden the spectrum of antimicrobial options available for use in both clinical and agricultural settings, offering a promising avenue for future drug development.</p>

<p>Trifluoroacetate salt</p>

<p>H-Asp-Phe-NH2 is a carboxy terminal amide of angiotensin, which is a peptide hormone. It is an analog of angiotensin II, which has been shown to have a number of therapeutic effects in the treatment of infectious diseases and cancer. H-Asp-Phe-NH2 has been shown to activate the angiotensin system by binding to serine protease, thereby regulating blood pressure and body fluid levels. This drug also has anti-inflammatory properties that may be due to its ability to inhibit prostaglandin synthesis. The optimal pH for this chemical reaction is 7.5. Structural studies on this compound have revealed that it can form hydrogen bonds with amino acids in proteins and tissues such as cysteine, histidine, and lysine.</p>

<p>Please enquire for more information about PAR-4 (1-6) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ne-Z-L-lysine tert-butyl ester hydrochloride is a multidrug that inhibits the activity of the P-glycoprotein (Pgp) transporter. This drug is an antigen that can be used as a marker for cytostatic drugs, and it can be used in radionuclide localization. Ne-Z-L-lysine tert-butyl ester hydrochloride has been shown to have cytostatic effects on malignant cells, but its cytotoxicity varies depending on the type of cancer cell. Ne-Z-L-lysine tert-butyl ester hydrochloride has also been shown to be degradable and to possess conjugates with antibodies, which makes it useful for treating some types of cancers. Ne-Z-L-lysine tert-butyl ester hydrochloride is not active against resistant cells such as those expressing Pgp or MRP1 proteins.</p>

<p>Trifluoroacetate salt</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Galanin (1-16) (mouse, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (2-34) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Leu-Tyr-OH is a biochemically reactive compound that can undergo a number of reactions with other substrates. It is an amide that is converted to the tripeptides, H-D-leu-tyr and H-D-Phe-Lys, by hydrolysis in the liver. It is also converted to the condensation products, H-D-leu and H2NCH2COOH, by hydrochloric acid or metal ions. The formation rate of this compound depends on its concentration. The rate of reaction increases with increased substrate concentrations. This compound has an acidic pH and binds to a bidentate ligand, histidine.</p>

<p>Please enquire for more information about Conantokin G (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Pro-Pro-Gly-Met-Arg-Pro-Pro-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr(tBu)-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Arg-Gly-Asp-Asn-Pro-OH is a cyclic peptide that is derived from the amino acid sequence of human collagen. It has been shown to have significant cytotoxicity and act as a chemoattractant for cells. H-Gly-Arg-Gly-Asp-Asn-Pro-OH has also been found to stimulate the growth of fibroblasts and increase the production of collagen, which is an important structural protein in connective tissue. HGRAAAP has been shown to have antiinflammatory properties and can be used to treat autoimmune diseases and infectious diseases, such as papillary muscle dysfunction, which is caused by inflammation. HGRAAAP may also be used to inhibit water permeability into cells, which would be helpful for the treatment of certain cancers that are caused by unregulated cell growth.</p>

<p>Please enquire for more information about Abz-Asp-Asp-Ile-Val-Pro-Cys-Ser-Met-Ser-3-nitro-Tyr-Thr-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C3a (72-77) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-Ser-Ala-Leu-OH is a chemical compound that has been shown to bind to 5-HT1B receptors. This receptor belongs to the 5HT1 family of serotonin receptors, which are G protein coupled receptors. The 5HT1B receptor has been shown to have a role in locomotor activity and dopamine release. HLSALLOH is also a specific antibody that reacts with the 5HT1B receptor in rats. The location of this receptor is on the dorsal raphe nucleus and other parts of the brainstem. HLSALLOH has a pH optimum of 6.0 and can be used as an immunogen for polyclonal antibodies against 5HT1B receptors.</p>

<p>L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide is a pharmacological agent that inhibits the toll-like receptor 4 signaling pathway. L-trans-Epoxysuccinyl-Ile-Pro-OMe propylamide has been shown to cause caspase independent cell death by inducing cathepsin and iron homeostasis. The drug also causes polymerase chain reaction inhibition and neuronal death in vivo.</p>

<p>1-Methyl-L-tryptophan is an activated form of the amino acid tryptophan. It has been shown to have immunomodulatory effects that are mediated by its ability to inhibit IDO1, which is an enzyme that regulates the production of inflammatory cytokines. 1-Methyl-L-tryptophan has been shown to reduce the severity of abdominal surgery in mice and exhibits anticancer activity against a variety of cancer cells. 1-Methyl-L-tryptophan also has antiemetic properties, as it has been shown to block the activation of 5HT3 receptors in the brainstem. This drug also activates polymerase chain reaction (PCR) and inhibits DNA synthesis by binding directly to DNA polymerase.</p>

<p>Please enquire for more information about H-Glu(D-Glu-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 8·18,Tyr34)-pTH (3-34) amide (bovine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Val-Fmoc)-OH is a biomolecule that is used for the synthesis of peptides. It has been shown to be an efficient synthetic method for the synthesis of peptides and isopeptides. The use of this biomolecule in peptide synthesis allows for the production of large quantities of peptides without racemization or epimerization that can occur with other methods. This synthetic method provides a means to produce both amino acid and dipeptide sequences, as well as the incorporation of non-natural amino acids.</p>

<p>Please enquire for more information about (Des-Gly10,D-Leu6, Orn 8,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-(2'-N-Boc-hydrazino)benzoic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Trp63,Trp64)-C3a (63-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-N-methylglycine is a modified form of the amino acid glycine, which has been modified to include a reactive group that can be used to link other molecules. This molecule has gram-negative bacterial activity and exhibits potent antibacterial activity against many gram-positive bacteria. Fmoc-N-methylglycine is also an antimicrobial peptide with binding constants in the nanomolar range. It is also an agent that binds to serotonin, which may explain its effects on mood and sleep. Fmoc-N-methylglycine can be synthesized using stepwise solid phase synthesis methods or by conjugation with other molecules.</p>

<p>Fmoc-a-Me-Lys(Boc)-OH is a versatile building block that can be used in the synthesis of complex compounds. It is a reagent and speciality chemical, which are substances used in research laboratories. Fmoc-a-Me-Lys(Boc)-OH has been used as an intermediate in the synthesis of drugs such as antihypertensive agents, anticonvulsants, and antibiotics. It has also been used as a reaction component in organic syntheses to produce peptides, polymers, and other compounds with biologically active properties.</p>

<p>Please enquire for more information about N-(4-Methoxyphenylazoformyl)-Arg-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Asp28)-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Perisulfakinin (PSK) is a cyclic peptide that has been isolated from the venom of the fly Phera insolita. PSK has a high affinity for protease activity and can be used as an inhibitor of proteases in control experiments. PSK is also an activator of cation channels and may be used as a neurotransmitter or neuromodulator in insects. The PSK peptide is present in dipteran species and can be seen by electron microscopy in their abdominal ganglia. PSK also activates Ca2+ influx into cells, which can lead to cell death. The PSK peptide is converted to cleavage products by enzymes, with bioassays being one way to measure these products.</p>