Amino Acids (AA)

<p>Please enquire for more information about H-beta-Chloro-Ala-NHOH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>6-Bromo-1-methylindazole is an industrial chemical that can be synthesized by the reaction of formate, methanol, and indazole. The synthesis method involves the esterification of methyl formate with indazole to produce 6-bromo-1-methylindazole. It can also be synthesized by the annulation of methyl formate and cyclopentadiene followed by hydrolysis. This chemical has several isomers that are distinguished from each other based on their synthesis methods. 6-Bromo-1-methylindazole has been shown to have a hydrolysis reaction when it reacts with water, producing methyl bromide and hydrogen bromide.</p>

<p>H-Pro-His-Leu-OH is a tripeptide with a sequence of L-proline, H-histidine, and D-leucine. It is an experimental substrate for peptide transporters and has been shown to be taken up by E. coli. This peptide is specific for Borrelia burgdorferi, the organism that causes Lyme disease.</p>

<p>Z-Ala-His-OH is a peptide consisting of three amino acids. It has been shown to have an optimal activity at pH 4.5, and can be recycled. Z-Ala-His-OH is synthesized by introducing the amino acid building blocks into a reaction system, where they are systematically introduced at different positions in order to produce the desired peptide sequence. Z-Ala-His-OH is an ionizable molecule that shows high affinity for the active site of its target enzyme. This property makes it useful in solvents with low dielectric constants, such as water or organic solvents with acidic properties. The kinetic behavior of this molecule has been studied systematically by measuring its rate of reaction in different solvents with different pH values and concentrations of reactants.END&gt;</p>

<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>

<p>3-Fluoro-4-methoxybenzoic acid is a dipolar molecule with a fluorine atom. It has been synthesized experimentally and the yields are determined by the experimental conditions. 3-Fluoro-4-methoxybenzoic acid has two isomers, which can be differentiated by their resonances. The molecule also has an asymmetric C3(CF)2Cl group in the middle of its structure that can rotate freely.</p>

<p>Please enquire for more information about Amyloid Bri Protein (1-34) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Gly10,D-Ser4,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is a synthetic substrate. It is used in tissue culture to measure collagenase activity, as well as in skin cells to measure the activity of v. anguillarum. The optimum pH for this substrate is 5.5 and it has been shown to be stable in high salt environments. This substrate also reacts with human liver granulosa cells and has been shown to have neutral pH properties. Z-Gly-Pro-Gly-Gly-Pro-Ala-OH is an enzyme substrate that is involved in many different enzyme activities including protein synthesis and hydrogen bonding.</p>

<p>Please enquire for more information about (Pyr 110)-Prepro-Urotensin II (110-123) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Val-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Leu-psi(CH2NH)Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Ala-Ala-Pro-Ile-pNA is an enzyme that belongs to the family of zymogens. It is a tetrapeptide that is synthesized in the cytosol and transported into the lumen of the intestine, where it is cleaved by trypsin to form pepsin A. In humans, this enzyme has been localized to the duodenum and jejunum. Suc-Ala-Ala-Pro-Ile-pNA is activated by trypsin and cleaves proteins at their carboxyl side chains. It also binds to specific residues in proteins, including those with unpaired cysteine residues.</p>

<p>Please enquire for more information about Osteoblast Activating Peptide (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Arg-Gly-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Substance P is a potent inhibitor of lung cancer cells, which may be due to its ability to signal through the cell membrane. It inhibits the growth of lung cancer cells by inhibiting signal transduction, leading to decreased cell proliferation and increased apoptosis. This product also has strong anti-inflammatory properties that can be used for the treatment of inflammatory diseases such as asthma.</p>

<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Dolastatin 15 (5S)-1-[(2S)-O-(N,N-Dimethyl-Val-Val-N-Me-Val-Pro-Pro)-2-hydroxyisovaleryl]-2-oxo-4-methoxy-5-benzylpyrrolidinium is a natural compound that has been isolated from the Indian Ocean sea hare Dolabella auricularia. It has shown significant cytotoxicity against cancer cells as well as significant immunosuppressive activities in animals. Dolastatin 15 is an analog of dolastatin 10 and has been shown to be active against hepatitis B and C virus. It also has antiinflammatory properties and may be effective in combating autoimmune diseases. The synthesis of this compound is an asymmetric synthesis with a hydroxyl group on one side of the molecule and an amide on the other side.</p>

<p>Conotoxins are peptides that can bind to specific receptors on the surface of cells. Their function is to regulate ion channels and thus affect cellular physiology. Conotoxin GIIIA is a disulfide-bonded peptide with a molecular weight of 5808 Da. It has been shown to inhibit Na+ channel activity in human serum, and may have diagnostic and therapeutic applications for diseases such as epilepsy. The amino acid sequence of conotoxin GIIIA is Arg-Asp-Cys-Cys-Thr-Hyp-Hyp-Lys-Lys-Cys-Lys-Asp-Arg-Gln-Cys (NH2)</p>

<p>Please enquire for more information about Boc-Gly-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urotensin I including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Met-Phe-Gly-OH is a hydrophobic amino acid. It has been shown to be present in human proteins, and it has been used as a marker for determining the sequence of amino acids in peptides. H-Met-Phe-Gly-OH is an acidic tripeptide that can be analysed using reversed phase high performance liquid chromatography (RPHPLC). This tripeptide is found in the peptide transporter, which transports amino acids across cellular membranes. The structural studies of H-Met-Phe-Gly-OH have revealed that this tripeptide has an alpha helix conformation, with two hydrogen bonds from the backbone amides to the backbone carbonyl groups.</p>

<p>Please enquire for more information about Z-Arg-Arg-4MbetaNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FA-Phe-Lys-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Methoxybenzyl chloride is a polymer conjugate that has the chemical formula C6H5CH2ClO. It reacts with hydroxy groups to form ester bonds. The compound was synthesized by reacting 3-methoxybenzyl chloride with hydrochloric acid in vitro, and the resulting product was found to have antimicrobial properties. In vivo studies have shown that this compound binds to receptors in rat striatal tissue. 3-Methoxybenzyl chloride also showed fluorescence properties when exposed to ultraviolet light and can be used for molecular modeling. Titration calorimetry has been used to study the thermal stability of this polymer conjugate.</p>

<p>Please enquire for more information about H-Asp(His-OH)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bz-D-Thr-OMe is a synthetic peptide with an amino acid sequence of Bz-D-Thr-OH. It has the chemical formula C14H24N2O4S and a molecular weight of 288.4 g/mol. This peptide reacts selectively with the n-terminal amino and carboxylic acids in peptides, cleaving the peptide bonds between these residues to produce free amino acids.</p>

<p>Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid is a pharmacokinetic drug that is under investigation for prostate cancer. It has been shown to inhibit the growth of prostate carcinoma cells and reduce the expression of prostate specific antigen (PSA) in vivo. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been used in bioconjugate chemistry to produce a prodrug that can be taken orally. This prodrug is activated by viral proteases in the stomach, leading to an increase in cytotoxicity against HIV virus and other retroviruses. Fmoc-(3S,4S)-4-amino-3-hydroxy-6-methylheptanoic acid has also been shown to inhibit the production of human serum erythropoietin (EPO).</p>

<p>Please enquire for more information about H-Lys-Leu-OH·HBr including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 1,2-Dihydro-1-Methyl-5-(Trifluoromethyl)-3H-Pyrazol-3-One including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The HCV-1 e2 protein (484-499) is a peptide that is a fragment of the HCV-1 e2 protein. It has been shown to be neuroprotective in vitro and in vivo, by inhibiting the production of reactive oxygen species and reducing cell death. The HCV-1 e2 protein (484-499) is also able to inhibit inflammatory responses in human pancreatic cells and fibrosis in autoimmune disease models. This peptide could be used as prophylaxis or treatment for neurodegenerative disease, pancreatic cancer, infectious diseases, autoimmune diseases, or fibrotic diseases.</p>

<p>Wang resins are the standard supports for the synthesis of peptide acids by solid phase synthesis (SPS) using the Fmoc strategy.Fmoc protected amino acids are linked to Polystyrene-PHB - which is Wang resin consisting of 1% crosslinked polystyrene functionalized with the TFA labile p-benzyloxybenzyl alcohol linker.</p>

<p>Ac-Ala-alpha-naphthyl ester is a chemical compound that belongs to the class of aromatic esters. It is used as a research and benchmarking agent in the measurement of skin penetration potential. Ac-Ala-alpha-naphthyl ester has been shown to have good skin penetration properties, with no adverse effects on the skin.</p>

<p>Z-Tyr-Lys-Arg-pNA·2 TFA is a potent inhibitor of proteases. It has been shown to be an efficient inhibitor of the major yeast protease, proteinase A, and other enzymes that are used for the industrial production of peptides. Z-Tyr-Lys-Arg-pNA·2 TFA is a synthetic peptide with a molecular mass of 5,836 Da and an optimum pH of 7.5. This peptide is synthesized by the chemical reaction between butoxycarbonyl (Boc) Lys(Z)-Tyr(N)-Arg(R)-pNA and 2 equivalents of trifluoroacetic acid (TFA). The synthesis takes place in a homogenous solution in dichloromethane at room temperature in the presence of triethylamine as base. Filtration through a 0.22 μm filter removes any insoluble impurities from the solution.</p>

<p>The Fmoc-His(Boc)-OPfp is a synthetic peptide that has been shown to bind to angiotensin. It is chemically reactive and can be used in diagnostic assays for the detection of angiotensin. The Fmoc-His(Boc)-OPfp can also be used as a feedback control for sequence analysis, where it monitors the reaction sequence by binding to the last amino acid in the peptide. This binding prevents the formation of an enzyme with the enzyme reaction necessary for cell wall biosynthesis, inhibiting protein synthesis and cell division.</p>

<p>Please enquire for more information about Anthranilyl-HIV Protease Substrate V trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-[D4]Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amylin is a peptide hormone that belongs to the group of hormones that include insulin and glucagon. Amylin has been shown to have an anti-diabetic effect in diabetic patients by stimulating insulin secretion and improving insulin sensitivity. Amylin inhibits protein aggregation, which may be due to its ability to form hydrogen bonds with other amyloid protein molecules. The structural biology of amylin has been studied using NMR spectroscopy and silver ions. This molecule has a sequence of H-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser, with a molecular weight of 3,726 Da.</p>

<p>Please enquire for more information about Fmoc-D-Lys(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-beta-Ala-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Boc-D-b-homoproline including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>

<p>Ac-Ile-Glu-Thr-Asp-PNA is a synthetic peptide that mimics the amino acid sequence of a region in the protein p67phox, which is a component of the mitochondrial membrane. Ac-Ile-Glu-Thr-Asp-PNA induces apoptosis by activating caspases and inhibiting ATP production. In vitro studies have shown this peptide to be active against hl60 cells, an inflammatory bowel disease cell line, as well as carcinoma cell lines derived from squamous cell carcinoma and carcinoma of the cervix. Ac-Ile-Glu-Thr-Asp-PNA also inhibits inflammatory cytokines such as IL1β, TNFα and IL6, which are associated with chronic inflammation.</p>

<p>N-(Hydroxymethyl)-phenylacetamide is an organic solvent that is used in the synthesis of certain antibiotics. It is a synthetic compound and can be obtained by reacting toluene with benzene, using a strong acid catalyst such as sulfuric acid. N-(Hydroxymethyl)-phenylacetamide has been used in the synthesis of isoquinolones, which are also antibiotics. This organic solvent can also be used for recrystallization, which is a process that helps purify solids from liquids or liquids from solids. The yield of this reaction is high, making it an efficient way to synthesize these compounds.</p>

<p>Please enquire for more information about Mca-Gly-Ser-Pro-Ala-Phe-Leu-Ala-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ala-Cys(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bradykinin is a peptide hormone that has been found to act through the bradykinin receptor. It has also been found to be an antagonist of the receptor, as it inhibits the growth of cells that are stimulated by bradykinin. This drug can be used for the treatment of asthma and other inflammatory diseases. The sequence of this drug is D-Arg0, Hyp 3,D-Phe7)-Bradykinin trifluoroacetate salt H-D-Arg-Arg-Pro-Hyp-Gly-Phe-Ser-D-Phe-Phe-Arg-OH trifluoroacetate salt.</p>

<p>H-Trp-Val-OH is a human protein that has been shown to be involved in the uptake of glucose into cells. H-Trp-Val-OH is also known as colony stimulating factor 1, which stimulates the growth and differentiation of hematopoietic cells. It has been shown to play a role in weight gain, insulin resistance, and type 2 diabetes. This monoclonal antibody has not been found to have any long term toxicity or genotoxicity in animal studies.</p>

<p>The synthesis of N-heptyl-hyp-OH is a chiral resolution process for the preparation of the enantiomers of heptanol. The enantioselective synthesis of this compound is achieved by converting the racemic mixture to an optically active form by means of a chiral auxiliary, followed by protection and hydrolysis. This method produces an optically pure product in high yield.</p>

<p>H-Tyr-Tyr-Tyr-OMe is a chiral, fluorinated, enantiomeric molecule that is synthesized by the reaction of an aryloxybenzene with tetrahydropyran and chlorine. This product has been used in asymmetric synthesis as a building block for pyrazole derivatives. It has also been used to produce alcohols and dialkylamino compounds.</p>

<p>Please enquire for more information about (D-Trp6,D-Leu7)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Lys(2-chloro-Z)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of tedizolid</p>

<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (Lys8)-Conopressin S including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-His-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys(isopropyl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Ser(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Methylthio-cis-zeatin is a corynebacterium metabolite that is produced by the oxidative deamination of 2-methylthioadenosine. It can be used as an indicator for the presence of corynebacteria in various plant species and has been found to have physiological functions such as multiple-reaction monitoring, biochemical analysis, and chemical structures. The production of 2-methylthio-cis-zeatin has been detected in tissue culture and explants from plants. Chemical analyses have shown that this metabolite is an impurity or contaminant in some pharmaceuticals and food products. 2-Methylthio-cis-zeatin can be identified using chromatographic methods with a mass spectrometric detection (MS) method, which allows for the identification of its isomers. This metabolite can also be analyzed using chromatographic methods with MS detection, which allows for the identification of its isomers</p>

<p>Bicine, also known as N,N-Bis(2-hydroxyethyl)glycine, is a Bis(2-hydroxyethyl) amine buffer with an optimal pH range of 7.6-9.0 and a pKa of 8.26. This buffering agent forms metal complexes and is used in crystallization and enzymatic studies.</p>

<p>Please enquire for more information about Fmoc-beta-Ala-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Tyr-OH is an amino acid derivative that has been shown to have anti-cancer properties. It inhibits the growth of cancer cells by binding to the surface of the tumor and inhibiting the production of angiogenic factors. This leads to a decrease in tumor size and an increase in light emission, which can be detected with light exposure. H-Glu-Tyr-OH also inhibits protein synthesis and cell proliferation, leading to death of tumor cells. The mechanism of action for H-Glu-Tyr-OH is through its ability to inhibit DNA topoisomerase I and II, which are enzymes that maintain the integrity of DNA. These enzymes are essential for DNA replication and transcription, so their inhibition results in cell death.</p>

<p>N-Benzoyl-N-phenylhydroxylamine is a compound that has been shown to be an optimum concentration for the production of molybdenum. It is a model system for the extraction and separation of molybdenum from other metals. The extraction process involves acidification with nitric acid, followed by precipitation with sodium benzoate. N-Benzoyl-N-phenylhydroxylamine is extracted using an electrode and then purified with a metal chelate. This compound has been shown to have synergistic effects when combined with vanadium, which may be due to their similar chemical properties.</p>

<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>

<p>Please enquire for more information about Entero-Kassinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Gly-Phe-Gly-Lys-OH is an allergen that belongs to the group of flavonoids. It is a reaction product of cinnamates and methoxycinnamate, which are found in sunscreens. Boc-Gly-Phe-Gly-Lys-OH is used as a model for chemical carcinogens in studies on cancer. Boc-Gly-Phe-Gly-Lys-OH has been shown to be a potent skin cancer and radiation sensitizer. There are no known effects on humans, but it is possible that this compound may react with UV irradiation from sunlight, causing DNA damage and skin cancer.</p>

<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (D-Arg0, Hyp 3,D-Phe7,Leu8)-Bradykinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(D-Val13)-alpha-MSH (11-13) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Leu-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>

<p>Please enquire for more information about H-His-Leu-His-bNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Arg(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>1-[(3,3-Diphenylpropyl)methylamino]-2-methyl-2-propanol is an epoxy that can be synthesized from benzene and lercanidipine. It has been used in the production of cinnamic acid and other molecules. This molecule can be prepared by reacting cinnamic acid with chloromethyl methyl ether in a ring-opening reaction. The chloride ion is utilized as a nucleophile to react with the amide nitrogen atom of the cinnamic acid molecule to form the amide bond. The large-scale production of 1-[(3,3-diphenylpropyl)methylamino]-2-methyl-2-propanol utilizes refluxing to remove water and other byproducts that are formed during the process.</p>

<p>1-Boc-1-methylhydrazine is a molecule that is used as a chemical intermediate for pharmaceuticals. It has been shown to inhibit the proteasome pathway by targeting the ubiquitin-proteasome system, which is involved in protein degradation and cell growth regulation. 1-Boc-1-methylhydrazine has synergistic effects when combined with other inhibitors of the ubiquitin proteasome system, such as anamorelin. It was found to be effective at inhibiting the growth of k562 cells but not normal cells, suggesting that it may have therapeutic applications for inflammatory bowel disease.</p>

<p>Propanedioic acid 1-methyl ester (PDM) is a synthetic trifluoroacetic acid ester of the natural fatty acid, propanedioic acid. It has been found to be a potent inhibitor of the enzyme malonic acid decarboxylase in vitro and has also been shown to inhibit the production of prostaglandin E2 in mice with adjuvant arthritis. PDM is used as a diagnostic agent for autoimmune diseases and inflammatory diseases. It is also being studied as an anti-inflammatory drug for use in the treatment of chronic inflammatory conditions such as rheumatoid arthritis, psoriasis, and ulcerative colitis. The mechanism of action is not well understood but may involve inhibition of arachidonic acid metabolism or inhibition of cyclooxygenase enzymes.</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Stresscopin-Related Peptide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone is a mitochondria-targeting compound that has been shown to have neuroprotective and anti-inflammatory properties. It binds to the ATP synthase in the mitochondrial membrane, inhibiting ATP production and causing cell death by apoptosis. ZAFMK also inhibits kinases such as protein kinase 3β (PK3β) and caspase 9, which are involved in inflammation and apoptosis. ZAFMK has been shown to be effective against various diseases such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease, and stroke.</p>

<p>H-Gly-Phe-Tyr-OH is a water soluble polymer that can be conjugated to drugs. The polymer is composed of methacrylamide and Gly, Phe, and Tyr residues. This polymer is used in the treatment of cancer by conjugating a drug to the polymer to make it water soluble. H-Gly-Phe-Tyr-OH can also be used as a polymeric carrier for docetaxel or gemcitabine.</p>

<p>IQB-782 is a mucolytic agent with mucolytic expectorant activity for the study of obstructive lung disease.</p>

<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>

<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Thr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>