Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(4,014 products)
- Amino Acid and Amino Acid Related Compounds(3,490 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38368 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
3-Methylcyclohex-2-en-1-one
CAS:3-Methylcyclohex-2-en-1-one is a chemical compound that is used in the synthesis of pharmaceuticals, pesticides, and other organic compounds. It has been shown to be effective against Dendroctonus species and other pests. 3-Methylcyclohex-2-en-1-one is synthesized from cyclohexanone by hydrogenation of the double bond at the 3 position. The reaction can be catalyzed by palladium complexes with acid complexing ligands, such as phosphines or amines. The product is then purified by distillation, crystallization, or recrystallization.Formula:C7H10OPurity:Min. 95%Molecular weight:110.15 g/molH-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2
CAS:Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H119N19O21SPurity:Min. 95%Molecular weight:1,582.86 g/mol3-Methoxybenzyl chloride
CAS:3-Methoxybenzyl chloride is a polymer conjugate that has the chemical formula C6H5CH2ClO. It reacts with hydroxy groups to form ester bonds. The compound was synthesized by reacting 3-methoxybenzyl chloride with hydrochloric acid in vitro, and the resulting product was found to have antimicrobial properties. In vivo studies have shown that this compound binds to receptors in rat striatal tissue. 3-Methoxybenzyl chloride also showed fluorescence properties when exposed to ultraviolet light and can be used for molecular modeling. Titration calorimetry has been used to study the thermal stability of this polymer conjugate.Formula:C8H9ClOPurity:Min. 95%Molecular weight:156.61 g/molAc-Gly-Ala-Lys-AMC trifluoroacetate salt
Please enquire for more information about Ac-Gly-Ala-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C23H31N5O6Purity:Min. 95%Molecular weight:473.52 g/molH-Ala-D-Ala-Ala-OH
CAS:Please enquire for more information about H-Ala-D-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C9H17N3O4Purity:Min. 95%Molecular weight:231.25 g/molBoc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid
CAS:Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C17H20F3NO4Purity:Min. 95%Molecular weight:359.34 g/molGRF (human) acetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molHirudin (54-65) (sulfated)
CAS:Hirudin is a protein that functions as an anticoagulant by binding to the active site of thrombin, preventing it from converting fibrinogen into fibrin. It has a high affinity for the thrombin receptor and can be modified in various ways. Hirudin's most common modification is sulfation, which enhances its anticoagulant activity. Hirudin is a proteolytic enzyme that can be synthesized using solid-phase chemistry. Its biological function is to inhibit blood coagulation by inhibiting the conversion of fibrinogen to fibrin. Hirudin binds to thrombin, preventing it from converting fibrinogen into fibrin and thus inhibits coagulation. It also prevents clot formation by inhibiting platelet aggregation, which may result from interactions with other proteins such as prothrombin and factor VIII.Formula:C66H93N13O28SPurity:Min. 95%Molecular weight:1,548.58 g/molSuc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt
CAS:Please enquire for more information about Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C66H88N14O14Purity:Min. 95%Molecular weight:1,301.49 g/mol2-Bromo-6-methylpyridin-3-ol
CAS:2-Bromo-6-methylpyridin-3-ol is a heterocyclic organic compound. It is a pyridine ring with two methyl groups attached to the ring at positions 2 and 6. The bromine atom is at position 3. This is an important intermediate in the Suzuki coupling reaction, which uses it as a starting material for the synthesis of many other compounds. The dieckmann condensation reaction produces this compound from 2,6-dichloropyridine and other reagents. Fluorescent when exposed to UV light, this compound has been used as a probe for chloride ions in solution using mass spectroscopy. This substance also yields dieckmann condensation products with alkynes and chlorine or bromine. 2-Bromo-6-methylpyridin-3-ol can be produced by treating pyridine with methylacrylate in the presence of catalysts such as copper(II)Formula:C6H6BrNOPurity:Min. 95%Molecular weight:188.02 g/molAcetyl-Exenatide trifluoroacetate salt
CAS:Please enquire for more information about Acetyl-Exenatide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C186H284N50O61SPurity:Min. 95%Molecular weight:4,228.61 g/molH-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH
CAS:H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH is a diacylglycerol that regulates the expression of genes and has been shown to modulate hematopoietic cells. This compound is a derivative of atypical proteins, which are proteins that have an atypical tertiary structure and do not possess a classical signal peptide or secretion signal. H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg -OH has been shown to be expressed in hematopoietic growth regulator domains, which may account for its pleiotropic effects on hematopoietic cells.Formula:C39H70N18O11Purity:Min. 95%Molecular weight:967.09 g/molPKI-tide
CAS:PKI-tide is a potent, selective inhibitor of the calcium/calmodulin-dependent protein kinase. It inhibits the activity of this enzyme and prevents the activation of other protein kinases by this enzyme. PKI-tide binds to the ATP site of the calcium/calmodulin-dependent protein kinase and blocks the binding of ATP and calmodulin. This inhibition prevents the phosphorylation of target proteins, including myosin light chain in muscle cells.
Formula:C85H149N31O24Purity:Min. 95%Molecular weight:1,989.29 g/molAmylin (mouse, rat) trifluoroacetate
CAS:Amylin (mouse, rat) trifluoroacetate is a synthetic peptide, which is a derivative of the islet amyloid polypeptide (IAPP) found in rodent species. It is sourced from the pancreatic beta cells of mice and rats, where it is co-secreted with insulin. The mode of action involves regulation of glucose metabolism through its effects on gastric emptying, glucagon secretion, and satiety. These actions are crucial in managing postprandial blood glucose levels and provide insights into the pathophysiology of diabetes.Amylin (mouse, rat) trifluoroacetate is primarily used in research applications to study the mechanisms of amylin aggregation and its implications in type 2 diabetes. It also serves as a model for understanding the differences in amyloid fibril formation between human and rodent amylin, making it invaluable for the development of therapeutic strategies aimed at mitigating amyloid-related cellular toxicity. Researchers utilize this peptide to explore the potential compensatory roles of amylin analogs in diabetic models, advancing our understanding of diabetes progression and treatment options.Formula:C167H272N52O53S2•(C2HF3O2)xPurity:Min. 95%Molecular weight:3,920.4 g/molZ-Trp-Gly-OH
CAS:Please enquire for more information about Z-Trp-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C21H21N3O5Purity:Min. 95%Molecular weight:395.41 g/mol(Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N16O12Purity:Min. 95%Molecular weight:1,209.4 g/mol(Ile3)-Pressinoic acid
CAS:Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/mol(Sar 9,Met(O2)11)-Substance P
CAS:Substance P is a neuropeptide that is found in the brain and throughout the peripheral nervous system. It has been found to be involved in numerous physiological processes, including pain transmission, vasodilation, and inflammation. Substance P binds to neurokinin-1 receptor (NK-1R) with high affinity. NK-1R has been shown to be localized on cells of the submandibular gland and salivary gland. Techniques such as binding experiments have shown that substance P binds to NK-1R with high affinity and is therefore likely involved in salivation and other functions of these glands.Formula:C64H100N18O15SPurity:Min. 95%Molecular weight:1,393.66 g/molBoc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh)
Please enquire for more information about Boc-Lys(2-chloro-Z)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Endomorphin-2 trifluoroacetate salt
CAS:Endomorphin-2 is a cyclic peptide that is the endogenous ligand for the neurokinin-1 receptor and kappa-opioid receptors. It has been shown to have analgesic, anti-inflammatory, and antidiarrheal properties. Endomorphin-2 also has been shown to inhibit platelet aggregation and vasoconstriction in vivo. The biological activities of endomorphin-2 are similar to those of endomorphin-1, but it differs structurally in that it contains a single intramolecular hydrogen bond between the amide nitrogen of Tyr and Pro. This intramolecular hydrogen bond may be responsible for the high potency of endomorphin-2, as well as its conformational stability.Formula:C32H37N5O5Purity:Min. 95%Molecular weight:571.67 g/mol
