Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30473 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
AUNP-12 TFA (1353563-85-5 free base)
<p>AUNP-12 TFA is a polypeptide that blocks PD-1, PD-L1, and PD-L2, safeguarding lymphocyte growth and function.</p>Formula:C144H227F3N40O50Purity:98%Color and Shape:SolidMolecular weight:3375.63β-Casomorphin, human TFA (102029-74-3 free base)
<p>β-Casomorphin, human TFA (Human β-casomorphin 7 TFA) an opioid peptide that ACTS as an opioid receptor agonist.</p>Formula:C46H62F3N7O13Purity:98%Color and Shape:SolidMolecular weight:978.02HBcAg [Hepatitis B virus] (18-27)
<p>HBcAg indicates active Hep B replication—suggests high transmission risk.</p>Formula:C58H78N10O15Purity:98%Color and Shape:SolidMolecular weight:1155.3Cyclo(RGDyK)
CAS:<p>Cyclo(RGDyK) is a potent and selective αVβ3 integrin inhibitor with IC50 of 20 nM.</p>Formula:C27H41N9O8Purity:98%Color and Shape:SolidMolecular weight:619.68Jagged-1 (188-204)
CAS:<p>Jagged-1 （188-204）is a fragment of the JAG-1 protein. JAG-1 is Notch ligand, a peptide that is the most conspicuously expressed ligand in skin.</p>Formula:C93H127N25O26S3Purity:98%Color and Shape:SolidMolecular weight:2107.4VIP(6-28)(human, rat, porcine, bovine) acetate
<p>VIP(6-28) acetate blocks VIP receptor, reducing cAMP in SCG across species.</p>Formula:C128H211N37O36SPurity:99.29%Color and Shape:SolidMolecular weight:2876.34ACTH (1-17) (TFA) (7266-47-9 free base)
<p>ACTH (1-17) TFA is a corticotrophin analogue and an effective human melanocortin 1 (MC1) receptor agonist with Ki value of 0.21 nM.</p>Formula:C95H145N29O23S·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:2207.43PKCε Inhibitor Peptide acetate
<p>PKCε Inhibitor Peptide acetate is a selective PKCε inhibitor containing the site for its specific receptor for activated C kinase (RACK).</p>Formula:C39H69N9O15Purity:98.93%Color and Shape:SolidMolecular weight:904.02Vasopressin
CAS:<p>Vasopressin: cyclic 9-peptide from hypothalamus, aids water reabsorption, blood pressure, and acts as neurotransmitter via G-protein receptors.</p>Formula:C46H65N15O12S2Purity:98%Color and Shape:SolidMolecular weight:1084.24Kisspeptin 10 (dog)
<p>Endogenous canine KISS1 receptor ligand; boosts LH, FSH, estradiol secretion.</p>Formula:C65H87N17O14Purity:98%Color and Shape:SolidMolecular weight:1330.51Ac-IEVDIDV (TFA)
<p>Ac-IEVDIDV TFA is a short peptide sequence.</p>Formula:C39H62F3N7O17Purity:98%Color and Shape:SolidMolecular weight:957.94Arg-Gly-Glu-Ser(TFA)(93674-97-6,free)
<p>Arg-gly-glu -Ser(TFA) is a RGD related polypeptide that controls the inhibition of fibrinogen binding to activated platelets by RGDS.</p>Formula:C18H30F3N7O10Purity:98%Color and Shape:SolidMolecular weight:561.47Neuropeptide Y (29-64), amide, human TFA
<p>Neuropeptide Y (29-64), human TFA, guards neurons against Alzheimer's and β-Amyloid toxicity.</p>Formula:C191H286F3N55O59SPurity:98%Color and Shape:SolidMolecular weight:4385.7β-Casomorphin (1-6), bovine
CAS:<p>β-Casomorphin (1-6), bovine is a opioid-like bioactive peptide of β-Casomorphin.</p>Formula:C35H44N6O8Purity:98%Color and Shape:SolidMolecular weight:676.76Elpamotide
CAS:<p>Elpamotide is a vaccine consisting of a VEGFR2-169 peptide.</p>Formula:C47H76N16O13Purity:98%Color and Shape:SolidMolecular weight:1073.21Pam2CSK4 Biotin
<p>biotinylated Pam2CSK4, a toll-like receptor 2/6 agonist</p>Formula:C87H162N14O16S2Purity:98%Color and Shape:SolidMolecular weight:1724.44Krds peptide
CAS:<p>Krds, a synthetic tetrapeptide from lactotransferrin residues 39-42, inhibits monoclonal antibody binding to GPIIb-IIIa in platelets and megakaryocytes.</p>Formula:C19H36N8O8Purity:98%Color and Shape:SolidMolecular weight:504.54Protein Kinase C Peptide Substrate
CAS:<p>PKC Peptide Substrate acts on cell spacers, driven by second messengers/adaptors due to external signals via g protein/tyrosine kinase receptors.</p>Formula:C83H155N39O21SPurity:98%Color and Shape:SolidMolecular weight:2067.43C112 Peptide
CAS:<p>C112 Peptide is a novel peptide.</p>Formula:C27H49N9O7Purity:98%Color and Shape:SolidMolecular weight:611.73Dusquetide aceate
<p>Dusquetide acetate: innate immune modulator with anti-inflammatory and antibacterial properties.</p>Formula:C27H51N9O7Purity:97.33%Color and Shape:SolidMolecular weight:613.75Ornipressin
CAS:<p>Ornipressin is a vasoconstrictor, haemostatic and renal agent.</p>Formula:C45H63N13O12S2Purity:98%Color and Shape:White PowderMolecular weight:1042.19Flagelin 22 acetate
<p>Flagelin 22 acetate is part of the bacterial flagellin family and is an effective inducer in plants and algae.</p>Formula:C95H166N32O36Purity:95.93%Color and Shape:SolidMolecular weight:2332.56Antennapedia Peptide FAM-labeled
<p>Antennapedia Peptide FAM-labeled, a fluorophore-tagged peptide, functions as a molecular probe in cancer research [1].</p>Color and Shape:Odour SolidDynorphin A (1-10) TFA(79994-24-4,free)
<p>Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.</p>Formula:C59H92F3N19O14Purity:98%Color and Shape:SolidMolecular weight:1348.48Selank
CAS:<p>Selank is a synthetic analog of tuftsin.</p>Formula:C33H57N11O9Purity:98%Color and Shape:SolidMolecular weight:751.87SIYRY
CAS:<p>SIYRY is a Kb-restricted epitope peptide.</p>Formula:C50H71N11O13Purity:98%Color and Shape:SolidMolecular weight:1034.16Sperm-activating peptide 1
CAS:<p>Sperm-activating peptide 1 is a bioactive chemical.</p>Formula:C44H71N11O12S2Purity:98%Color and Shape:SolidMolecular weight:1010.23survivin (baculoviral IAP repeat-containing protein 5) (21-28)
<p>Survivin, often up-regulated in tumors, inhibits apoptosis and regulates mitosis, linking high levels to poor cancer prognosis.</p>Formula:C54H73N11O11Purity:98%Color and Shape:SolidMolecular weight:1052.22Locustamyotropin
CAS:<p>Locustamyotropin is a novel peptide isolated from Leucophae maderae; stimulates the spontaneous contractions of the hindgut of Leucophaea maderae.</p>Formula:C55H89N17O14Purity:98%Color and Shape:SolidMolecular weight:1212.4Trempamotide
CAS:<p>Trempamotide is a bioactive chemical.</p>Formula:C58H80N10O18Purity:98%Color and Shape:SolidMolecular weight:1205.31M-2420
CAS:<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Formula:C70H91N15O27Purity:98%Color and Shape:SolidMolecular weight:1574.56RLLFT-NH2
CAS:<p>TFLLR-NH2, reversed amino acid sequence control peptide, is a PAR1 selective agonist that significantly increases the nociceptive threshold.</p>Formula:C31H53N9O6Purity:98%Color and Shape:SolidMolecular weight:647.81AmmTX3 TFA
<p>AmmTX3 TFA, a peptide toxin derived from Androctonus mauretanicus scorpion venom, functions as a selective blocker of the K_v4 channel.</p>Formula:C158H262N50O48S6·xC2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3822.47 (free acid)Phytochelatin 4
CAS:<p>Phytochelatin 4 (PC 4) a heavy metal detoxifier/chelator consisting of 4 units of glu - cys , tolerant to Cd (cadmium), ultimately sequestered in the vesicle.</p>Formula:C34H53N9O18S4Purity:95.98%Color and Shape:SolidMolecular weight:1004.09WT-1 A1
CAS:<p>WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.</p>Formula:C55H74N10O13SPurity:98%Color and Shape:SolidMolecular weight:1115.3Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:<p>Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.</p>Formula:C32H45N9O10SPurity:98%Color and Shape:SolidMolecular weight:747.82Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Purity:98%Color and Shape:SolidMolecular weight:3692.15Palmitoyl dipeptide-7
CAS:<p>Palmitoyl dipeptide-7 is a peptide.</p>Formula:C26H51N3O5Purity:98%Color and Shape:SolidMolecular weight:485.7cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Formula:C126H202N42O40S2Purity:98%Color and Shape:SolidMolecular weight:3009.36CLIP (86-100) (TFA) (648881-58-7 free base)
<p>CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.</p>Formula:C74H129F3N20O21S3Purity:98%Color and Shape:SolidMolecular weight:1788.13Caerulein, desulfated TFA (20994-83-6 free base)
<p>Caerulein, desulfated TFA, is a desulfurized decapeptide similar to gastrin/CCK's five C-terminal amino acids.</p>Formula:C60H74F3N13O20SPurity:98%Color and Shape:SolidMolecular weight:1386.36Z-Gly-Pro-Phe-Leu-CHO
CAS:<p>Z-Gly-Pro-Phe-Leu-CHO (Z-GPFL-CHO) is a tetrapeptide aldehyde serving as a selective and potent proteasome inhibitor, demonstrating inhibition constants (Ki) of</p>Formula:C30H38N4O6Purity:98%Color and Shape:SolidMolecular weight:550.65X-press Tag Peptide
<p>X-press Tag: an N-terminal peptide with polyhistidine, T7 gene 10 Xpress epitope, and enterokinase site, detected by anti-Xpress antibodies.</p>Formula:C41H59N9O20Purity:98%Color and Shape:SolidMolecular weight:997.96Ac-LETD-AFC
CAS:<p>Ac-LETD-AFC is a fluorescent substrate that can be specifically cleaved by caspase-8. λEx(nm) of Ac-LETD-AFC is 400 nm and λEm is 505 nm.</p>Formula:C31H38F3N5O12Purity:99.67%Color and Shape:SolidMolecular weight:729.65Activated Protein C (390-404), human
CAS:<p>Human Activated Protein C (390-404) peptide derived from serine protease, suppresses APC anticoagulation.</p>Formula:C91H130N22O23Purity:98%Color and Shape:SolidMolecular weight:1900.14Biotin-Crosstide TFA
<p>Biotin-crosstide is a derivative of the peptide Akt substrate crosstide, featuring biotinylation.</p>Formula:C58H91N19O19S·XCF3COOHColor and Shape:SolidMolecular weight:1390.53Proadrenomedullin (45-92), human
CAS:<p>Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM.</p>Formula:C215H359N67O73S2Purity:98%Color and Shape:SolidMolecular weight:5114.76Adrenomedullin (AM) (1-52), human
CAS:<p>Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.</p>Formula:C264H406N80O77S3Purity:98%Color and Shape:SolidMolecular weight:6028.82Somatostatin-28 (1-12)
CAS:<p>Somatostatin-28 (1-12) is a somatostatin fragment which is monitored in brain tissue to track processing of somatostatin.</p>Formula:C49H81N17O19SPurity:98%Color and Shape:SolidMolecular weight:1244.33BDC2.5 mimotope 1040-51
CAS:<p>BDC2.5 mimotope 1040-51 is an agonistic peptide for T cells in diabetic NOD mice.</p>Formula:C60H99N17O13SPurity:98%Color and Shape:SolidMolecular weight:1298.6Extracellular Death Factor TFA
<p>Extracellular death factor TFA (EDF TFA) is a linear pentapeptide that communicating cells produce and release, which activates the cell death pathway.</p>Purity:98.77%Color and Shape:Odour SolidAPP-018
CAS:<p>APP-018 (D-4F) is an 18 D-amino acid peptide that mimics apolipoprotein A-I (apoA-I). It enhances the anti-inflammatory properties of high-density lipoprotein (HDL) and is applicable in cardiovascular disease research.</p>Formula:C114H156N24O28Color and Shape:SolidMolecular weight:2310.6Ribonuclease A
CAS:<p>Ribonuclease A (RNase A) is a potent endonuclease that removes RNA during dna and protein preparation.</p>Color and Shape:SolidLeu-Val
CAS:<p>Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.</p>Formula:C11H22N2O3Purity:97.72%Color and Shape:SolidMolecular weight:230.3Caerulein, desulfated ammonium
<p>Caerulein, desulfated ammonium is a desulfated Caerulein formed by hydrolysis of Caerulein stimulating lipase secretion and inhibits gastric acid secretion.</p>Formula:C58H76N14O18SPurity:98.64%Color and Shape:SolidMolecular weight:1289.37Thanatin acetate
Thanatin acetate is a cationic peptide with antimicrobial activity, inhibiting bacterial and fungal growth.Formula:C105H181N35O29S3Purity:99.65%Color and Shape:SolidMolecular weight:2493.97CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formula:C162H262N50O52S2Purity:98%Color and Shape:SolidMolecular weight:3806.3Preprosomatostatin (25-34)
CAS:<p>Preprosomatostatin (25-34) is a peptide.</p>Formula:C52H83N17O15Purity:98%Color and Shape:SolidMolecular weight:1186.32type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
<p>Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).</p>Formula:C47H77N13O15Purity:98%Color and Shape:SolidMolecular weight:1064.19Fibrinogen-Binding Peptide
CAS:<p>Fibrinogen-binding peptide mimics vitronectin site and activates platelets; thrombin turns it to fibrin.</p>Formula:C25H39N7O8Purity:98%Color and Shape:SolidMolecular weight:565.62DSTYSLSSTLTLSK acetate
<p>DSTYSLSSTLTLSK acetate is a human generic peptide that can be used for the quantitative detection of infliximab.</p>Formula:C66H111N15O28Purity:98%Color and Shape:SolidMolecular weight:1562.67OVA sequence (323-336)
CAS:<p>This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencity</p>Formula:C63H100N20O22Purity:98%Color and Shape:SolidMolecular weight:1489.59Competence-Stimulating Peptide-12261
CAS:<p>Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.</p>Formula:C100H149N31O23Purity:98%Color and Shape:SolidMolecular weight:2153.45Thymocartin
CAS:<p>Thymocartin (RGH 0206) is a fragment 32-35 of the naturally occurring thymic factor (thymopoietin).Thymocartin is used in the study of immunodeficiency diseases</p>Formula:C21H40N8O7Purity:98%Color and Shape:SolidMolecular weight:516.59GRP (porcine)
CAS:<p>GRP: agonist for GRPR, stimulates amygdala GABA release reducing fear in mice, aids mitogenesis, GI function, and appetite control.</p>Formula:C126H198N38O31S2Purity:98%Color and Shape:SolidMolecular weight:2805.31Xenin
CAS:<p>Xenin is a 25 amino acid peptide that has been identified in human gastric mucosa in the search for a counterpart to the amphibian octapeptide xenopsin.</p>Formula:C139H224N38O32SPurity:98%Color and Shape:SolidMolecular weight:2971.57Smcy HY Peptide (738-746)
CAS:<p>Smcy HY Peptide (738-746) is an H2-Db-restricted peptide, derived from the amino acid sequence 738 to 746 of the Smcy protein.</p>Formula:C48H82N18O14SPurity:98%Color and Shape:SolidMolecular weight:1167.34Allatostatin II
CAS:<p>Allatostatin II is an Inhibitors of juvenile hormone synthesis in insects.</p>Formula:C49H74N14O13Purity:98%Color and Shape:SolidMolecular weight:1067.2PR 39 (porcine) acetate
<p>PR 39 (porcine) acetate is a noncompetitive, reversible and allosteric proteasome inhibitor.</p>Purity:98%Color and Shape:LiquidMolecular weight:N/ACeratotoxin A acetate
<p>Ceratotoxin A acetate is isolated from the accessory gland secretion fluid, with anti-bacterial effects.</p>Formula:C137H247N35O34Purity:98.49%Color and Shape:SolidMolecular weight:2928.64Saniculoside R 1
CAS:<p>Saniculoside R 1 is a new triterpenoid saponin from Sanicula europaea.</p>Formula:C52H84O22Purity:98%Color and Shape:SolidMolecular weight:1061.222TAT TFA (191936-91-1 free base)
<p>TAT TFA (YGRKKRRQRRR) is derived from human immunodeficiency virus (hiv-1) transcription reverse activator TAT, is a cell penetrating peptide.</p>Formula:C66H119N32F3O16Purity:98%Color and Shape:SolidMolecular weight:1673.85Lamin fragment
<p>Lamin: α-helical, intermediate filament protein; key in nuclear lamina structure & nuclear functions; sequence: Lys-Ala-Gly-Gln-Val-Val-Thr-Ile-Trp.</p>Formula:C47H76N12O12Purity:98%Color and Shape:SolidMolecular weight:1001.18Rac1 Inhibitor F56, control peptide
CAS:<p>Control peptide version of Rac1 Inhibitor; comprises residues 45-60 of Rac1 with Trp56 replaced by Phe. Does not affect GEF-Rac1 interaction.</p>Formula:C72H116N18O23SPurity:98%Color and Shape:SolidMolecular weight:1632.89Maraciclatide
CAS:<p>Maraciclatide is a radiopharmaceutical targeting αvβ3 integrin.</p>Formula:C72H120N20O21S3Purity:98%Color and Shape:SolidMolecular weight:1698.05β-Secretase inhibitor-STA
CAS:<p>BACE-IN-1 is amyloid precursor protein beta-secretase inhibitor</p>Formula:C73H118N16O27Purity:98%Color and Shape:SolidMolecular weight:1651.81Cerebellin
CAS:<p>Cerebellin: 16-amino acid peptide, from rat cerebellum, now found in human adrenal glands, mainly medullary chromaffin cells.</p>Formula:C69H113N23O23Purity:98%Color and Shape:SolidMolecular weight:1632.78HIV-1 TAT 48-60
<p>HIV-1 TAT (48-60) is a cell-penetrating peptide from HIV-1 Tat protein residues 48-60.</p>Formula:C70H131N35O16Purity:98%Color and Shape:SolidMolecular weight:1719GroES mobile loop
<p>GroES mobile loop is a flexible region of unbound GroES that interacts with GroEL via the residues located at the tip of the loop.</p>Formula:C51H90N14O20Purity:98%Color and Shape:SolidMolecular weight:1219.4R 892
CAS:<p>Bradykinin B1 antagonist, ID50: 2.8 nM (B1), >600 nM (B2), no agonist action, aminopeptidase/ACE resistant, causes hypertension in vivo.</p>Formula:C58H83N13O12Purity:98%Color and Shape:SolidMolecular weight:1154.37amyloid A protein fragment [Homo sapiens]
<p>Amyloid A proteins are apolipoproteins in HDL linked to inflammation, with acute-phase marker SAA rising rapidly post-stimulus, potentially outpacing CRP.</p>Formula:C36H56N8O11Purity:98%Color and Shape:SolidMolecular weight:776.88RA X Peptide
CAS:<p>RA X Peptide is used as an antitumor cyclic hexapeptide.</p>Formula:C43H52N6O11Purity:98%Color and Shape:SolidMolecular weight:828.92OVA G4 peptide TFA (148274-82-2 free base)
<p>G4 peptide (SIIGFEKL) is a modified OVA peptide (257-264) that binds to mouse MHC class I H-2Kb.</p>Formula:C45H72F3N9O14Purity:98%Color and Shape:SolidMolecular weight:1020.1ReACp53 acetate
<p>ReACp53 acetate could inhibit p53 amyloid formation and rescue p53 function in cancer cell lines.</p>Formula:C110H210N52O26Purity:99.55%Color and Shape:SolidMolecular weight:2677.18TAT-DEF-Elk-1 TFA (1220751-16-5 free base)
<p>TAT-DEF-Elk-1 TFA: a peptide that inhibits Elk-1, blocking its phosphorylation and nuclear entry, without affecting ERK/MSK1.</p>Formula:C157H260N57F3O42Purity:98%Color and Shape:SolidMolecular weight:3675.09Z-Asp(OBzl)-OH
CAS:<p>Z-Asp(OBzl)-OH (N-Cbz-L-Aspartic acid 4-benzyl ester) is an aspartic acid derivative.</p>Formula:C19H19NO6Purity:98.71%Color and Shape:SolidMolecular weight:357.36H-Val-Pro-Pro-OH TFA (58872-39-2 free base)
<p>H-Val-Pro-Pro-OH(TFA), a proline peptide derivative from milk, is an ACE inhibitor with IC50 of 9 M.</p>Formula:C17H26F3N3O6Purity:98%Color and Shape:SolidMolecular weight:425.4Tyroserleutide TFA (138168-48-6 free base)
<p>Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.</p>Formula:C20H28F3N3O8Purity:98%Color and Shape:SolidMolecular weight:495.45VIP(Guinea pig)
CAS:<p>Neuropeptide with many biological actions</p>Formula:C147H239N43O42S2Purity:98%Color and Shape:SolidMolecular weight:3344.86TNF-α (31-45), human TFA (144796-71-4 free base)
<p>TNF-α (31-45), human (TFA) is a peptide of tumor necrosis factor-α.</p>Formula:C71H123F3N26O24Purity:98%Color and Shape:SolidMolecular weight:1781.89Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
<p>Blocker of bovine endothelial NOS (599-613), inhibits NO production, useful in managing ischemic injury and inflammation.</p>Formula:C85H127N25O27SPurity:98%Color and Shape:SolidMolecular weight:1963.13PYX 1
CAS:<p>PYX 1 is an effective orexigenic peptide.</p>Formula:C70H105Cl2N19O16Purity:98%Color and Shape:SolidMolecular weight:1539.61TAK-683 TFA (872719-49-8 free base)
<p>TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.</p>Formula:C66H84F3N17O15Purity:98%Color and Shape:SolidMolecular weight:1412.47GRGDSPK acetate
CAS:<p>GRGDSPK acetate shows inhibitory activity against integrin-fibronectin binding and can be used in research on integrins in bone formation and resorption.</p>Formula:C30H53N11O13Purity:97.9%Color and Shape:SoildMolecular weight:775.81RETF-4NA acetate
<p>RETF-4NA acetate is a sensitive, specific substrate for chymotrypsin.</p>Formula:C34H47N9O12Purity:97.6400%Color and Shape:SolidMolecular weight:773.79vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
<p>Vitamin D-binding protein transports vitamin D, has immune roles, is highly polymorphic, and responds to dietary strontium.</p>Formula:C54H95N17O17Purity:98%Color and Shape:SolidMolecular weight:1254.44immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
<p>Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.</p>Formula:C54H83N13O13Purity:98%Color and Shape:SolidMolecular weight:1122.32Cytochrome c fragment (93-108)
<p>Cytochrome c: small heme protein in mitochondria, has methylated lysines in some eukaryotes, essential for Apaf-1.</p>Formula:C79H133N23O25Purity:98%Color and Shape:SolidMolecular weight:1805.04Cardiotoxin Analog (CTX) IV (6-12)
CAS:<p>Cardiotoxin Analog (CTX) IV (6-12) is a part peptide of Cardiotoxin Analog (CTX) IV. Cardiotoxin analogues IV isolated from the venom of Taiwan Cobra.</p>Formula:C48H70N10O7Purity:98%Color and Shape:SolidMolecular weight:899.13BDC2.5 mimotope 1040-31 TFA(329696-49-3 free base)
<p>This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5.</p>Formula:C65H98F3N17O16SPurity:98%Color and Shape:SolidMolecular weight:1462.63CRF, bovine TFA (92307-52-3 free base)
<p>CRF, bovine (TFA), agonizes CRF receptor, displacing [125I-Tyr]ovine CRF, Ki 3.52 nM, pEC50s: hCRF1 11.16, hCRF2 8.53, rCRF2α 8.70.</p>Formula:C208H341F3N60O65SPurity:98%Color and Shape:SolidMolecular weight:4811.36Semax
CAS:<p>Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH) that has neuroprotective, analgesic, and anxiolytic properties.</p>Formula:C37H51N9O10SPurity:98%Color and Shape:SolidMolecular weight:813.93F-Chemotactic peptide-fluorescein
CAS:<p>F-Chemotactic peptide-fluorescein is a fluorescent label.</p>Formula:C64H76N8O14SPurity:98%Color and Shape:SolidMolecular weight:1213.41SPACE peptide acetate
<p>SPACE peptide acetate is a skin penetrating peptide that facilitates the transfer of molecules through the skin.</p>Purity:98%Color and Shape:SolidJAG-1, scrambled
CAS:<p>This peptide is a scrambled sequence of JAG-1(188-204).</p>Formula:C93H127N25O26S3Purity:98%Color and Shape:SolidMolecular weight:2107.35MARCKS Peptide(151-175), Phosphorylated
<p>Myristoylated Alanine-Rich C Kinase Substrate peptide (151-175) is a high affinity Protein Kinase C substrate.</p>Formula:C147H246N41O40P3Purity:98%Color and Shape:SolidMolecular weight:3320.8Secretin (33-59), rat TFA (121028-49-7 free base)
<p>Secretin (33-59), rat (TFA), a 27-aa peptide, stimulates pancreatic secretion of bicarbonate, enzymes, and K+.</p>Formula:C131H217F3N42O44Purity:98%Color and Shape:SolidMolecular weight:3141.37Agavoside C
CAS:<p>Agavoside C is a biochemical.</p>Formula:C50H80O23Purity:98%Color and Shape:SolidMolecular weight:1049.167Sphistin Synthetic Peptide
<p>Sphistin peptide (12-38, FITC-labeled N-terminus) is a potent antimicrobial truncated fragment.</p>Formula:C159H250N50O37SPurity:98%Color and Shape:SolidMolecular weight:3486.06Triletide
CAS:<p>Triletide is a thromboxane A2 antagonist agent.</p>Formula:C27H31N5O5Purity:98%Color and Shape:SolidMolecular weight:505.57Neuronostatin-13 human acetate
<p>Neuronostatin-13 human acetate is a 13-amino acid peptide hormone, which plays an important role in the regulation of hormonal and cardiac function.</p>Formula:C66H114N20O18Purity:98%Color and Shape:SolidMolecular weight:1475.73Z-VRPR-FMK (TFA)
<p>Z-VRPR-FMK (TFA) is a tetrapeptide that selectively and irreversibly inhibits MALT1 in lymphoid tissue.</p>Formula:C33H50F4N10O8Purity:98%Color and Shape:SolidMolecular weight:790.81Apraglutide TFA (1295353-98-8 free base)
<p>Apraglutide TFA is a synthetic 33-amino acid, long-acting GLP-2 analog that promotes intestine growth in short bowel syndrome.</p>Formula:C172H263N43O52·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3879.27PKItide
CAS:<p>PKItide demonstrates an inhibitory concentration 50 (IC50) of 0.2 μM against cAMP-dependent protein kinase (cAMP-PK) [1].</p>Formula:C85H149N31O24Purity:98%Color and Shape:SolidMolecular weight:1989.29GNQWFI
CAS:<p>GNQWFI, an anti-Flt1 peptide, functions as a VEGFR1-specific antagonist. It inhibits interactions between VEGFR1 and various ligands, such as VEGFA, VEGFB, and placental growth factor (PIGF), and suppresses VEGF-induced endothelial cell migration and tubulogenesis. GNQWFI holds potential for research in cancer, asthma, and other ocular diseases.</p>Formula:C37H49N9O9Color and Shape:SolidMolecular weight:763.84CALP3 TFA(261969-05-5 free base)
<p>CALP3 TFA is a potent Ca2+ channel blocker that activates EF-hand motifs of Ca2+-binding proteins.</p>Formula:C46H69F3N10O11Purity:98%Color and Shape:SolidMolecular weight:995.1Neuromedin S(rat)
CAS:<p>Endogenous agonist for NMU receptors (EC50: NMU1=65 pM, NMU2=91 pM), shifts locomotor circadian rhythm, suppresses appetite.</p>Formula:C193H307N57O49SPurity:98%Color and Shape:SolidMolecular weight:4241.97[D-Trp7,9,10]-Substance P acetate
<p>[D-Trp7,9,10]-Substance P acetate is an analogue of substance P which inhibits ion conductance through nicotinic acetylcholine receptors.</p>Formula:C81H109N21O15SPurity:96.41%Color and Shape:SolidMolecular weight:1648.93CGGRGD
CAS:<p>CGGRGD, an RGD derivative with cysteine, synthesized via solid phase and added to PCL fiber with 2-cyanobenzothiazole for ammoniation.</p>Formula:C19H33N9O9SPurity:98%Color and Shape:SolidMolecular weight:563.59β-Casomorphin (1-3), amide
CAS:<p>β-Casomorphin (1-3), amide is a peptide fragment of β-Casomorphin with 3 amino acid.</p>Formula:C23H28N4O4Purity:98%Color and Shape:SolidMolecular weight:424.49Conotoxin GII
CAS:<p>Conotoxin GII is a highly toxic peptide.</p>Formula:C57H81N19O16S4Purity:98%Color and Shape:SolidMolecular weight:1416.63PD-1/PD-L1-IN 3 TFA (1629654-95-0 free base)
<p>PD-1/PD-L1-IN 3 TFA inhibits the binding of human PD-1 to PD-Ll with an IC50 of 9 nM.</p>Formula:C91H127F3N24O20SPurity:98%Color and Shape:SolidMolecular weight:1966.19β-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Formula:C49H76N12O15Purity:98%Color and Shape:SolidMolecular weight:1073.2FITC-β-Ala-β-Amyloid (25-35)
<p>FITC-β-Ala-β-Amyloid (25-35) is a FITC-labeled fluorescent compound utilized in Alzheimer's disease research [1].</p>Color and Shape:Odour SolidAc-DNLD-CHO
CAS:<p>Ac-DNLD-CHO (Ac-Asp-Asn-Leu-Asp-CHO) is an inhibitor of Caspase-3/7, exhibiting IC50 values of 9.89 nM and 245 nM, and approximate Ki values of 0.68 nM and 55.7</p>Formula:C20H31N5O10Purity:98%Color and Shape:SolidMolecular weight:501.49H-Ala-Ala-Tyr-OH (TFA) (67131-52-6 free base)
<p>H-Ala-Ala-Tyr-OH TFA can be synthesized mutant peptides.</p>Formula:C17H22F3N3O7Purity:98%Color and Shape:SolidMolecular weight:437.37Jingzhaotoxin-V
<p>Jingzhaotoxin-V, a 29-residue polypeptide from Chilobrachys jingzhao spider venom, selectively inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium</p>Formula:C157H243N47O37S7Purity:98%Color and Shape:SolidMolecular weight:3605.36Colistin A
CAS:<p>Colistin A, from Paenibacillus polymyxa, is an antibiotic effective against Gram-negative bacilli, part of the polymyxin class.</p>Formula:C53H100N16O13Purity:98%Color and Shape:SolidMolecular weight:1169.46Hirullin P18
CAS:<p>Hirullin P18 is a potent thrombin inhibitor with anticoagulant properties [1].</p>Formula:C68H96N14O29Purity:98%Color and Shape:SolidMolecular weight:1573.57Ac-AAVALLPAVLLALLAP-YVAD-CHO
CAS:<p>Ac-AAVALLPAVLLALLAP-YVAD-CHO is a cell-permeable inhibitor of caspase-1 exhibiting antitumor activity [1].</p>Formula:C97H160N20O24Purity:98%Color and Shape:SolidMolecular weight:1990.43Maurocalcine
CAS:<p>Maurocalcine is a cell-permeable agonist for ryanodine receptor (RyR) subtypes 1, 2, and 3.</p>Formula:C156H270N56O46S6Purity:98%Color and Shape:SolidMolecular weight:3858.55Heteropodatoxin-2
CAS:<p>Heteropodatoxin-2, a 30-amino acid peptide, inhibits the Kv4.2 current in Xenopus laevis oocytes through a voltage-dependent mechanism, exhibiting reduced</p>Formula:C144H207N39O46S6Purity:98%Color and Shape:SolidMolecular weight:3412.81Anthopleurin-C
<p>Anthopleurin-C (APE 2-1) is a cardiotonic polypeptide exhibiting a potent positive inotropic effect [1].</p>Formula:C210H316N62O61S6Purity:98%Color and Shape:SolidMolecular weight:4877.52Tertiapin-RQ
<p>Tertiapin-RQ, an inward rectifier potassium (K+) channel-blocking peptide, exhibits antidepressant effects [1].</p>Formula:C106H175N37O25S4Purity:98%Color and Shape:SolidMolecular weight:2496.02ω-Conotoxin Bu8
<p>ω-Conotoxin Bu8 is a 25-amino-acid-residue ω-conotoxin that features three disulfide bridges.</p>Formula:C103H174N42O35S6Purity:98%Color and Shape:SolidMolecular weight:2753.13GAD65(247-266) epitope TFA
<p>GAD65(247-266) epitope TFA, a T cell epitope derived from islet antigens, exhibits competitive binding to the type I diabetes-associated molecule I-A g7, albeit</p>Formula:C111H174F3N27O29S4Purity:98%Color and Shape:SolidMolecular weight:2535.99Scorpion toxin Tf2
<p>Scorpion toxin Tf2, a β-scorpion toxin first identified in the venom of the Brazilian scorpion Tityus fasciolatus, acts as an activator of the neuronal voltage-</p>Formula:C309H438N80O87S9Purity:98%Color and Shape:SolidMolecular weight:6953.86µ-Conotoxin BuIIIA
<p>μ-Conotoxin BuIIIA (Mu-Conotoxin BuIIIA), a toxin derived from Cone snail venom, functions as a voltage-gated sodium channel (VGSC) blocker.</p>Formula:C106H172N44O31S6Purity:98%Color and Shape:SolidMolecular weight:2751.17μ-Conotoxin PIIIA
CAS:<p>μ-Conotoxin PIIIA, isolated from Conus purpurascens [1] [2], is a blocker of the sodium channel NaV 1.4.</p>Formula:C103H166N40O28S6Purity:98%Color and Shape:SolidMolecular weight:2605.06Fibronectin Adhesion-promoting Peptide TFA
<p>Fibronectin peptide aids MSC aggregation by heparin-binding, promoting spheroid assembly.</p>Formula:C49H75F3N16O12Purity:98%Color and Shape:SolidMolecular weight:1137.22TriDAP
CAS:<p>TriDAP (L-Ala-γ-D-Glu-meso-diaminopimelic acid), a biologically active peptide, functions as a specific Nod1 activator.</p>Formula:C15H26N4O8Purity:98%Color and Shape:SolidMolecular weight:390.39Allatostatin IV
CAS:<p>Allatostatin IV, an insect octapeptide, regulates juvenile hormone synthesis.</p>Formula:C45H68N12O12Purity:98%Color and Shape:SolidMolecular weight:969.09Antennapedia Peptide
CAS:<p>Antennapedia Peptide: 16-mer from Drosophila domain, induces cellular uptake.</p>Formula:C104H168N34O20SPurity:98%Color and Shape:SolidMolecular weight:2246.8Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone is a cell-permeable, non-toxic inhibitor that irreversibly binds to activated</p>Formula:C43H45FN4O16Purity:98%Color and Shape:SolidMolecular weight:892.83mP6
CAS:<p>mP6 (Myr-FEEERA-OH), a myristoylated peptide, selectively inhibits Gα 13's interaction with integrin β 3 while preserving talin-dependent integrin function.</p>Formula:C47H75N9O14Purity:98%Color and Shape:SolidMolecular weight:990.15β-MSH (1-22) human TFA (17908-57-5 free base)
β-Melanocyte Stimulating Hormone (MSH) is a 22-residue human peptide acting as a melanocortin-4 receptor agonist.Formula:C120H175F3N34O37SPurity:98%Color and Shape:SolidMolecular weight:2774.94ω-Conotoxin CVIF
<p>ω-Conotoxin CVIF is a selective inhibitor of Ca v 2.2 channels, demonstrating an IC50 value of 34.3 nM in isolated rat DRG neurons.</p>Formula:C101H170N40O33S6Purity:98%Color and Shape:SolidMolecular weight:2665.07Pep1-TGL
<p>Peptide containing the 'TGL' motif that corresponds to the C-terminus of GluR1 subunit</p>Formula:C41H71N11O15SPurity:98%Color and Shape:SolidMolecular weight:990.14ACTH (1-13)
CAS:<p>ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.</p>Formula:C75H106N20O19SPurity:98%Color and Shape:SolidMolecular weight:1623.83N-Acetylcarnosine acetate
<p>N-Acetylcarnosine acetate, a dipeptide, yields L-carnosine and treats human cataracts.</p>Formula:C13H20N4O6Purity:98%Color and Shape:SolidMolecular weight:328.32α-Conotoxin Vc1.1 TFA
<p>α-Conotoxin Vc1.1 TFA is a peptide isolated from Conus victoriae and is also a nAChR antagonist that can be used to study neuropathic chronic pain.</p>Formula:C73H108F3N23O27S4Purity:97.57%Color and Shape:SolidMolecular weight:1925.03N-Oleoyl Valine Ammonium salt
<p>N-Oleoyl Valine Ammonium salt is an N-acyl amide compound that is a TRPV3 antagonist and can be used to study inflammation.</p>Formula:C23H46N2O3Purity:99.72%Color and Shape:SolidMolecular weight:398.62Locustapyrokinin II
CAS:<p>Locustapyrokinin II is a member of the FXPRL-amide peptide family isolated from Locusta migratoria.</p>Formula:C65H98N16O17Purity:98%Color and Shape:SolidMolecular weight:1375.594BCMA72-80
CAS:<p>BCMA72-80: HLA-A2-specific peptide with high affinity; used in multiple myeloma and other BCMA+ tumor research.</p>Formula:C59H97N13O11SPurity:98%Color and Shape:SolidMolecular weight:1196.55Endo-1,3-β-glucanase
CAS:<p>Endo-1,3-β-glucanase (Lyticase) is a glucanase from fungi and Chlamydomonas reinhardtii that displays lytic activity on fungal cells.</p>Color and Shape:SolidCortistatin-14 TFA (186901-48-4 free base)
<p>Cortistatin-14 is a neuropeptide have structural similarity to somatostatin-14. It is produced in the cortex and hippocampus of central nervous system.</p>Formula:C83H115F3N20O20S2Purity:98%Color and Shape:SolidMolecular weight:1834.05eukaryotic translation initiation factor 3
<p>Eukaryotic initiation factors (eIF) are proteins involved in the initiation phase of eukaryotic translation.</p>Formula:C47H84N14O14SPurity:98%Color and Shape:SolidMolecular weight:1101.32[Des-octanoyl]-Ghrelin (rat)
CAS:<p>[Des-octanoyl]-Ghrelin (rat) is a Non-acylated, major circulating isoform of ghrelin.</p>Formula:C139H231N45O41Purity:98%Color and Shape:SolidMolecular weight:3188.6Ac-Leu-Arg-AMC
CAS:<p>Ac-Leu-Arg-AMC is a fluorogenic peptide substrate.</p>Formula:C24H34N6O5Purity:98%Color and Shape:SolidMolecular weight:486.56BPC 157 (X acetate)
CAS:<p>Body Protection Compound 157 (BPC 157) is a pentadecapeptide derived from BPC, identified in gastric juice, exhibiting diverse biological activities. At 2 µg/ml, BPC 157 enhances primary rat tendon fibroblast cell migration and F-actin formation. Furthermore, doses of 0.01 and 10 µg/kg, intraperitoneally (i.p.), mitigate paw swelling, bone erosion, and mononuclear cell infiltration in the joints of rats with rheumatoid arthritis induced by complete Freund's adjuvant (CFA). It also diminishes gastric ulcer size in rats caused by indomethacin, aspirin, or diclofenac at these doses. Additionally, BPC 157 reduces catalepsy duration and tremor severity in a mouse model of Parkinson's disease triggered by MPTP.</p>Formula:C62H98N16O22XC2H4O2Color and Shape:SolidMolecular weight:1419.54Acetyl-PHF6 amide(TFA) (878663-43-5 free base)
<p>Acetyl-PHF6 amide TFA is a tau derived hexapeptide.</p>Formula:C40H64F3N9O11Purity:98%Color and Shape:SolidMolecular weight:903.99OVA G4 peptide
CAS:<p>G4 peptide (SIIGFEKL), a variant of ovalbumin epitope SIINFEKL, binds to mouse MHC class I H-2Kb.</p>Formula:C43H71N9O12Purity:98%Color and Shape:SolidMolecular weight:906.08Xenin-8
CAS:<p>neurotensin-like peptide that modulate pancreatic insulin and glucagon secretion/effects</p>Formula:C51H79N15O9Purity:98%Color and Shape:SolidMolecular weight:1046.27Fmoc N-hydroxysuccinimide ester
CAS:Formula:C19H15NO5Purity:≥ 98.0%Color and Shape:White to off-white crystalline powderMolecular weight:337.34RYTVELA TFA
CAS:<p>RYTVELA TFA is a variant interleukin-1 receptor inhibitor with anti-inflammatory activity for the prevention of preterm labor and fetal protection.</p>Formula:C38H62N10O12Color and Shape:SolidMolecular weight:850.96Acetyl tetrapeptide-2
CAS:<p>Acetyl tetrapeptide-2 is a skin conditioner, by soothing and nourishing the skin through similar mechanisms as other peptides.</p>Formula:C26H39N5O9Purity:98%Color and Shape:SolidMolecular weight:565.62Trifluoroacetic acid
CAS:Formula:CF3CO2HPurity:(Titration) ≥ 99.0%Color and Shape:Clear, colourless to faint yellow liquidMolecular weight:114.02CTP-NBD
CAS:<p>CTP-NBD is a cell-permeable, specific inhibitor of the NFκB peptide, which has been utilized in studies of colitis [1] [2].</p>Formula:C121H194N46O32Purity:98%Color and Shape:SolidMolecular weight:2805.12A 71915
CAS:<p>A 71915, an atrial natricuretic factor receptor antagonist, blocks physiological effects of angiotensin.</p>Formula:C69H116N26O15S2Purity:98%Color and Shape:SolidMolecular weight:1613.97AD 01
CAS:<p>FKBPL-based peptide increases CD44, hinders BCSC growth, impacts pluripotency, inhibits angiogenesis, and blocks tumor growth in models.</p>Formula:C115H187N33O42Purity:98%Color and Shape:SolidMolecular weight:2703.94DB21, Galectin-1 Antagonist
CAS:<p>DB21, Galectin-1 Antagonist, is a peptidomimetic conjugated with dibenzofuran, serving as an allosteric inhibitor of galectin-1 (GAL1) interactions with glycans</p>Formula:C83H136N18O19Purity:98%Color and Shape:SolidMolecular weight:1690.08Thioredoxin reductase peptide
CAS:<p>TrxR peptide (53-67) aids TrxR research, has C-terminal selenylsulfide, similar to glutathione reductase.</p>Formula:C66H106N18O18S2Purity:98%Color and Shape:SolidMolecular weight:1503.79SN50 TFA
<p>SN50 TFA is an inhibitor of NF-κB and attenuates alveolar hypercoagulation and fibrinolysis inhibition. SN50 TFA can be used in studies about ARDS.</p>Formula:C129H230N36O29S·XCF3COOHColor and Shape:SolidMolecular weight:2781.5 (free base)FITC-Ahx-Gly-Arg-Gly-Asp-Ser-Pro
CAS:<p>FITC-Ahx-Gly-Arg-Gly-Asp-Ser-Pro, also known as FITC-linked GRGDSP, is a fluorescent peptide with integrin inhibitory properties.</p>Formula:C49H59N11O16SPurity:98%Color and Shape:SolidMolecular weight:1090.12HATU
CAS:Formula:C10H15F6N6OPPurity:≥ 99.0%Color and Shape:White crystalline powderMolecular weight:380.23Hm1a
<p>Hm1a, a disulfide-rich spider-venom peptide and NaV1.1 activator, reestablishes the function of inhibitory interneurons in a Dravet syndrome (DS) mouse model [1</p>Formula:C170H239N47O54S6Purity:98%Color and Shape:SolidMolecular weight:3997.39μ-Conotoxin SxIIIC
<p>μ-Conotoxin SxIIIC, an irreversible NaV channel inhibitor, is derived from Conus striolatus and is useful in researching neurological disorders, including</p>Formula:C90H142N42O27S6Purity:98%Color and Shape:SolidMolecular weight:2436.75Hainantoxin-III
CAS:<p>Jingzhaotoxin-V is a peptide that suppresses potassium currents in Xenopus laevis oocytes, exhibiting an IC50 of 604.2 nM, while concurrently targeting both</p>Formula:C154H228N44O45S6Purity:98%Color and Shape:SolidMolecular weight:3608.12Mambalgin-3
<p>Mambalgin-3, an acid-sensitive ion channel 1 (ASIC1) inhibitor, has potential applications in analgesia research [1].</p>Formula:C274H433N85O83S10Purity:98%Color and Shape:SolidMolecular weight:6566.54Aurein 1.2
CAS:<p>Aurein 1.2, an amphibian-derived peptide, exhibits both antibiotic and anticancer properties [1].</p>Formula:C71H114N16O18Purity:98%Color and Shape:SolidMolecular weight:1479.76Maurotoxin
CAS:<p>Maurotoxin, a 34-residue peptide featuring four disulfide bridges, is extracted from the chactoid scorpion (Scorpio maurus) and known to impede Shaker potassium</p>Formula:C145H232N46O46S8Purity:98%Color and Shape:SolidMolecular weight:3612.19Hainantoxin-IV
CAS:<p>Hainantoxin-IV acts as a specific antagonist for tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with His28 and Lys32 being critical residues for</p>Formula:C166H257N53O50S6Purity:98%Color and Shape:SolidMolecular weight:3987.53μ-TRTX-Hd1a
<p>μ-TRTX-Hd1a, a spider venom-derived compound, selectively inhibits the human NaV 1.7 channel by functioning as a gating modifier.</p>Formula:C160H246N46O51S6Purity:98%Color and Shape:SolidMolecular weight:3822.33TNF-α (10-36), human
CAS:<p>TNF-α (10-36), human is a potent pro-inflammatory cytokine involved in the acute phase stress response.</p>Formula:C131H211N43O38Purity:98%Color and Shape:SolidMolecular weight:2996.34Super Fluor 488, SE
<p>Super Fluor 488, SE is a dye for labeling biomolecules, offering high-brightness and sensitivity without self-quenching.</p>Purity:98%Color and Shape:SolidMolecular weight:N/ACytochrome P450 CYP1B1 (190-198) [Homo sapiens]
<p>Cytochrome c: small heme protein, in mitochondria, has methylated lysines in some eukaryotes, crucial for Apaf-1 function.</p>Formula:C50H80N12O13Purity:98%Color and Shape:SolidMolecular weight:1057.24Substance P(1-4) Acetate
<p>Substance P(1-4) Acetate is a neurokinin receptor (NK-R) antagonist, inhibiting the formation of PV EEC.</p>Formula:C24H44N8O7Purity:99.84%Color and Shape:SolidMolecular weight:556.66MAIT 203
<p>Inhibits interaction of APC and Asef (RhoGEF4). Inhibits colorectal cancer cell migration and invasion in vitro.</p>Formula:C106H177N43O29Purity:98%Color and Shape:SolidMolecular weight:2517.83Tertiapin-Q acetate
<p>Tertiapin-Q acetate is a bee toxin derivative that inhibits BK-type K(+) channels in a concentration-dependent manner.</p>Formula:C108H179N35O26S4Purity:96.44%Color and Shape:SolidMolecular weight:2512.06Super-TDU (1-31) TFA
<p>Super-tdu (1-31) TFA is an endogenous ligand of heptapeptide receptor and has a strong anti-analgesic effect.</p>Formula:C141H218N40O48·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3355.5Pterinotoxin-1
<p>Pterinotoxin-1 is a peptide toxin that functions as an inhibitor of sodium channels [1].</p>Formula:C163H251N49O53S7Purity:98%Color and Shape:SolidMolecular weight:3969.49Fibrinopeptide A, human
CAS:<p>Human Fibrinopeptide A: 16-residue peptide from fibrinogen's Aα region, cleaved by thrombin.</p>Formula:C63H97N19O26Purity:98%Color and Shape:White Lyophilized PowderMolecular weight:1536.56N,N''-Carbonyldiimidazole
CAS:Formula:C7H6N4OPurity:(Titration) ≥ 97.0%Color and Shape:White, off-white or pale yellow powder or crystalsMolecular weight:162.15Phosphorylase Kinase β-Subunit Fragment (420-436)
CAS:<p>Phosphorylase Kinase β-Subunit Fragment (420-436) is a peptide fragment (430-436) derived from the β-Subunit of phosphorylase kinase.</p>Formula:C79H131N31O25SPurity:98%Color and Shape:SolidMolecular weight:1947.14IGF-I (30-41) TFA(82177-09-1,FREE)
<p>IGF-I (30-41) (TFA) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I).</p>Formula:C51H83N19O19·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:1380.36Caveolin-1 (82-101) amide (human, mouse, rat)
CAS:<p>Caveolin-1 (82-101) amide (human, mouse, rat), also known as Caveolin-1 scaffolding domain peptide, mitigates aging-related detrimental alterations in various</p>Formula:C124H170N28O29Purity:98%Color and Shape:SolidMolecular weight:2516.85Dermcidin-1L (human)
CAS:<p>Dermcidin-1L (human), an antibiotic peptide secreted by sweat glands, exhibits antimicrobial activity and is utilized in the research of inflammatory skin</p>Formula:C210H359N57O71Purity:98%Color and Shape:SolidMolecular weight:4818.44Dendrotoxin-I
CAS:<p>Dendrotoxin-I, a neurotoxin from Dendroaspis snake venom, potently blocks K⁺ channels, specifically targeting voltage-gated potassium channel subunits KV1.1 and</p>Formula:C312H491N99O83S6Purity:98%Color and Shape:SolidMolecular weight:7149.24TBTU
CAS:Formula:C11H16BF4N5OPurity:≥ 99.0%Color and Shape:White to almost white powderMolecular weight:321.08
![HBcAg [Hepatitis B virus] (18-27)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2231.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![amyloid A protein fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2176.webp&w=3840&q=75)
![vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2190.webp&w=3840&q=75)
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![[D-Trp7,9,10]-Substance P acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1932L1.webp&w=3840&q=75)
![[Des-octanoyl]-Ghrelin (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2242.webp&w=3840&q=75)
![Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2238.webp&w=3840&q=75)
