Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30473 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Abecomotide
CAS:<p>Abecomotide is a bioactive chemical.</p>Formula:C45H79N13O16Purity:98%Color and Shape:SolidMolecular weight:1058.19A2-Binding peptide
CAS:<p>A2-Binding peptide has involved in the assembly of MHC Class I molecules.</p>Formula:C61H106N14O15Purity:98%Color and Shape:SolidMolecular weight:1275.602Super-TDU (1-31) TFA
<p>Super-tdu (1-31) TFA is an endogenous ligand of heptapeptide receptor and has a strong anti-analgesic effect.</p>Formula:C141H218N40O48·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:3355.5Adrenomedullin (AM) (1-52), human TFA
<p>Adrenomedullin (AM) (1-52), human (TFA) is an NH2 terminal truncated adrenomedullin analogue,affects cell proliferation and angiogenesis in cancer.</p>Formula:C266H407F3N80O79S3Purity:98%Color and Shape:SolidMolecular weight:6142.76TCS 184
CAS:<p>Scrambled control peptide for use with TCS 183</p>Formula:C58H96N20O20SPurity:98%Color and Shape:SolidMolecular weight:1425.57Urocortin III, mouse TFA (357952-10-4 free base)
<p>Urocortin III, a mouse peptide, activates CRF-R2, affecting stress response and social behavior in the medial amygdala.</p>Formula:C188H313N52F3O54S2Purity:98%Color and Shape:SolidMolecular weight:4286.99Recanaclotide
CAS:<p>Recanaclotide can be used to treat Gastroparesis, Functional Dyspepsia, and Other Gastrointestinal Disorders.</p>Formula:C45H71N14O20PS6Purity:98%Color and Shape:SolidMolecular weight:1351.49PKC ζ pseudosubstrate
<p>Inhibitor of protein kinase C (PKC) ζ; attached to cell permeabilisation Antennapedia domain vector peptide.</p>Formula:C208H336N74O44S3Purity:98%Color and Shape:SolidMolecular weight:4673.59Rhodopsin peptide
Rhodopsin peptide: H2N-Val-Ser-Lys-Thr-Glu-Thr-Ser-Gln-Val-Ala-Pro-Ala-OH, MW=1217.33; light-sensitive, linked to retinopathies.Formula:C51H88N14O20Purity:98%Color and Shape:SolidMolecular weight:1217.33Gly-Phe β-naphthylamide acetate
<p>Gly-Phe β-naphthylamide acetate is the substrate of Cathepsin C and can be used for research on the function of cathepsin C, intralysosomal hydrolysis and</p>Formula:C23H25N3O4Purity:99.56%Color and Shape:SolidMolecular weight:407.46Quinupristin (mesylate) (120138-50-3 free base)
<p>Quinupristin: a streptogramin antibiotic combatting multidrug-resistant S. aureus and Enterococcus.</p>Formula:C53H68N9O10S·CH3SO3Purity:98%Color and Shape:SolidMolecular weight:1118.3NEP(1-40)
CAS:<p>Nogo-66 (1–40) peptide blocks NgR, enhances axonal growth, and aids spinal recovery, but doesn't affect MAG inhibition.</p>Formula:C206H324N56O65Purity:98%Color and Shape:SolidMolecular weight:4625.16Velmupressin
CAS:<p>Peptidic V2R agonist, c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2, with EC50: 0.07 nM (hV2R), 0.02 nM (rV2R); selective, short-acting.</p>Formula:C42H60ClN11O8S2Purity:98%Color and Shape:SolidMolecular weight:946.58LCMV gp33-41 (TFA) (151705-84-9 free base)
<p>LCMV gp33-41 (TFA) is an 11-aa peptide, MHC class I H-2Db-bound, presented to CTLs.</p>Formula:C50H74N11F3015SPurity:98%Color and Shape:SolidMolecular weight:1158.24β-amyloid (12-28) (TFA) (107015-83-8 free base)
<p>β-amyloid (12-28) TFA, a peptide fragment of β-amyloid protein (β1-42), is the major component of senile plaque cores.</p>Formula:C91H136N25F3O27Purity:98%Color and Shape:SolidMolecular weight:2069.2β-Secretase inhibitor-STA
CAS:<p>BACE-IN-1 is amyloid precursor protein beta-secretase inhibitor</p>Formula:C73H118N16O27Purity:98%Color and Shape:SolidMolecular weight:1651.81APTSTAT3-9R acetate
<p>APTSTAT3-9R acetate is a selective peptide binding STAT3 with antiproliferative and antitumor activity.</p>Formula:C225H334N80O53Purity:98%Color and Shape:SolidMolecular weight:5007.56MAP kinase fragment [Multiple species]
<p>MAP kinase fragment, peptide Lys-Tyr-Ile-His-Ser-Ala-Asn-Val-Leu, part of the serine/threonine-specific CMGC kinase group.</p>Formula:C48H77N13O13Purity:98%Color and Shape:SolidMolecular weight:1044.2Cucumarioside A6-2
CAS:<p>Cucumarioside A6-2 is a triterpene glycoside.</p>Formula:C59H92NaO32S2Purity:98%Color and Shape:SolidMolecular weight:1400.46Peptide 399
CAS:Peptide 399 is an antimicrobial peptide with an idealized amphiphilic alpha helix.Formula:C84H162N20O15Purity:98%Color and Shape:SolidMolecular weight:1692.345Lys-phe-phe-phe-ile-ile-trp-och3
CAS:<p>Lys-phe-phe-phe-ile-ile-trp-och3 is a hydrophobic peptide which reacts with lipid vesicles.</p>Formula:C57H75N9O8Purity:98%Color and Shape:SolidMolecular weight:1014.26egg white lysozyme (19-36) [Gallus gallus]
<p>Hen egg-white lysozyme, ~14.6 kDa with 129 amino acids, catalyzes hydrolysis of bacterial cell walls' glycosidic bonds.</p>Formula:C86H144N28O23S2Purity:98%Color and Shape:SolidMolecular weight:2002.37Latromotide
CAS:<p>Latromotide is an antineoplastic agent.</p>Formula:C60H105N17O12Purity:98%Color and Shape:SolidMolecular weight:1256.58P110
CAS:<p>Drp1 inhibitor blocks its GTPase, preserves mitochondrial function, and reduces ROS and cell death, aiding Parkinson's model.</p>Formula:C100H179N45O25Purity:98%Color and Shape:SolidMolecular weight:2411.8VV-Hemorphin-7
CAS:<p>VV-Hemorphin-7 is a morphinomimetic peptide.</p>Formula:C59H82N14O13Purity:98%Color and Shape:SolidMolecular weight:1195.37TAT-DEF-Elk-1 TFA (1220751-16-5 free base)
<p>TAT-DEF-Elk-1 TFA: a peptide that inhibits Elk-1, blocking its phosphorylation and nuclear entry, without affecting ERK/MSK1.</p>Formula:C157H260N57F3O42Purity:98%Color and Shape:SolidMolecular weight:3675.09Lactoferrin (17-41) TFA (146897-68-9 free base)
<p>Lactoferricin B (amino acids 17-41 of lactoferrin) enhances anti-fungal agents against Candida Albicans.</p>Formula:C143H225F3N46O31S3Purity:98%Color and Shape:SolidMolecular weight:3237.79CLIP (86-100) (TFA) (648881-58-7 free base)
<p>CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.</p>Formula:C74H129F3N20O21S3Purity:98%Color and Shape:SolidMolecular weight:1788.13Competence-Stimulating Peptide-12261
CAS:<p>Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.</p>Formula:C100H149N31O23Purity:98%Color and Shape:SolidMolecular weight:2153.45Bacterial Sortase Substrate III, Abz/DNP (TFA)
<p>Abz/DNP TFA is a quenched fluorescent peptide, cleaved by SrtA in Staphylococcus aureus, forming amide bonds in cell walls.</p>Formula:C43H58N11F3O16Purity:98%Color and Shape:SolidMolecular weight:1042.02Ceratotoxin A acetate
<p>Ceratotoxin A acetate is isolated from the accessory gland secretion fluid, with anti-bacterial effects.</p>Formula:C137H247N35O34Purity:98.49%Color and Shape:SolidMolecular weight:2928.64Dusquetide aceate
<p>Dusquetide acetate: innate immune modulator with anti-inflammatory and antibacterial properties.</p>Formula:C27H51N9O7Purity:97.33%Color and Shape:SolidMolecular weight:613.75Pam2CSK4 Biotin
<p>biotinylated Pam2CSK4, a toll-like receptor 2/6 agonist</p>Formula:C87H162N14O16S2Purity:98%Color and Shape:SolidMolecular weight:1724.44BCMA72-80
CAS:<p>BCMA72-80: HLA-A2-specific peptide with high affinity; used in multiple myeloma and other BCMA+ tumor research.</p>Formula:C59H97N13O11SPurity:98%Color and Shape:SolidMolecular weight:1196.55M-2420
CAS:<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Formula:C70H91N15O27Purity:98%Color and Shape:SolidMolecular weight:1574.56IGF-I (30-41) TFA(82177-09-1,FREE)
<p>IGF-I (30-41) (TFA) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I).</p>Formula:C51H83N19O19·C2HF3O2Purity:98%Color and Shape:SolidMolecular weight:1380.36[SER140]-PLP(139-151)
CAS:<p>[SER140]-PLP(139-151) is a polypeptide fragment of the lipid protein of myelin.</p>Formula:C72H104N20O17Purity:98%Color and Shape:SolidMolecular weight:1521.72Leucokinin VIII
<p>Leucokinin VIII is an diuretic octapeptide isolated form head extracts of the cockroach.</p>Formula:C42H52N10O11Purity:98%Color and Shape:SolidMolecular weight:872.92Ornipressin
CAS:<p>Ornipressin is a vasoconstrictor, haemostatic and renal agent.</p>Formula:C45H63N13O12S2Purity:98%Color and Shape:White PowderMolecular weight:1042.19Dynorphin A (1-10) TFA(79994-24-4,free)
<p>Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.</p>Formula:C59H92F3N19O14Purity:98%Color and Shape:SolidMolecular weight:1348.48ProTx III
<p>Potent Nav1.7 inhibitor (IC50=2.5nM); blocks Nav1.1/1.2/1.3/1.6; no Cav/nAChR impact at 5μM; analgesic; counters scorpion toxin OD1.</p>Formula:C162H246N52O43S6Purity:98%Color and Shape:SolidMolecular weight:3802.41PKCα (C2-4) inhibitor peptide
<p>PKCα (C2-4) inhibitor peptide is a specific antagonist to PKCα that impedes the α1A-adrenoreceptor agonist A-61603 [1] from inhibiting I_Kr.</p>Formula:C47H74N14O17Purity:98%Color and Shape:SolidMolecular weight:1107.17TAT TFA (191936-91-1 free base)
<p>TAT TFA (YGRKKRRQRRR) is derived from human immunodeficiency virus (hiv-1) transcription reverse activator TAT, is a cell penetrating peptide.</p>Formula:C66H119N32F3O16Purity:98%Color and Shape:SolidMolecular weight:1673.85Sperm-activating peptide 1
CAS:<p>Sperm-activating peptide 1 is a bioactive chemical.</p>Formula:C44H71N11O12S2Purity:98%Color and Shape:SolidMolecular weight:1010.23Flagelin 22 acetate
<p>Flagelin 22 acetate is part of the bacterial flagellin family and is an effective inducer in plants and algae.</p>Formula:C95H166N32O36Purity:95.93%Color and Shape:SolidMolecular weight:2332.56µ-Conotoxin-CnIIIC
CAS:<p>μ-Conotoxin-CnIIIC, a 22-residue conopeptide derived from Conus consors, acts as a potent and persistent NaV1.4 channel blocker, exhibiting analgesic,</p>Formula:C92H139N35O28S6Purity:98%Color and Shape:SolidMolecular weight:2375.7Asudemotide
CAS:<p>Asudemotide is a bioactive chemical.</p>Formula:C58H80N10O17Purity:98%Color and Shape:SolidMolecular weight:1189.31rGHRH(1-29)NH2
<p>RGHRH (1-29)NH2 is a synthetic peptide that stimulates the secretion of growth hormone (GH).</p>Formula:C155H251N49O40SPurity:98%Color and Shape:SolidMolecular weight:3473.02Fibrinopeptide B, human TFA (36204-23-6 free base)
<p>FibrinopeptideB,human is a 14-amino acid polypeptide released from the amino terminus of the fibrinogen segment.</p>Formula:C68H94F3N19O27Purity:98%Color and Shape:SolidMolecular weight:1666.58Decabassianolide
CAS:<p>Decabassianolide is a biochemical.</p>Formula:C60H105N5O15Purity:98%Color and Shape:SolidMolecular weight:1136.52Peptide VF13N
CAS:<p>Peptide VF13N is a synthetic rabies virus glycoprotein T helper cell epitope.</p>Formula:C57H88N14O23SPurity:98%Color and Shape:SolidMolecular weight:1369.45Xenin 8 acetate
<p>Xenin 8 acetate is a biologically active fragment of Xenin in the neurotensin/xenopsin family.</p>Formula:C53H83N15O11Purity:95.54%Color and Shape:SoildMolecular weight:1106.32Knqdk peptide
CAS:<p>Knqdk peptide is a synthetic pentapeptide, located in residues 112-116 of bovine K-casein.</p>Formula:C25H45N9O10Purity:98%Color and Shape:SolidMolecular weight:631.68GLGPNPCRKKCYKRDFLGR
<p>GLGPNPCRKKCYKRDFLGR is a synthetic peptide.</p>Formula:C96H158N32O24S2Purity:98%Color and Shape:SolidMolecular weight:2208.64TCS 183
<p>competitive inhibitor of GSK-3β (Ser9) phosphorylation</p>Formula:C58H96N20O20SPurity:98%Color and Shape:SolidMolecular weight:1425.58Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]
<p>Cytochrome c: small heme protein, in mitochondria, has methylated lysines in some eukaryotes, crucial for Apaf-1 function.</p>Formula:C50H80N12O13Purity:98%Color and Shape:SolidMolecular weight:1057.24NocII
CAS:<p>Orphan neuropeptide,stimulates locomotion in mice</p>Formula:C92H141N23O28S2Purity:98%Color and Shape:SolidMolecular weight:2081.37HIV-1 TAT 48-60
<p>HIV-1 TAT (48-60) is a cell-penetrating peptide from HIV-1 Tat protein residues 48-60.</p>Formula:C70H131N35O16Purity:98%Color and Shape:SolidMolecular weight:17195-CR110 [5-Carboxyrhodamine 110] *Single isomer*
<p>CR110 reagents are more photostable and pH-independent than FITC/FAM, with optimal absorption at 488 nm.</p>Formula:C21H15N2O5ClPurity:98%Color and Shape:SolidMolecular weight:410.81HPV16 E7 (86-93) acetate
<p>HPV16 E7 (86-93) acetate is a derived peptide of human leukocyte antigen A2.1 restricted HPV16 E7 with immunogenic property in cervical carcinomas.</p>Formula:C39H70N8O12SPurity:96.9100%Color and Shape:SolidMolecular weight:875.08matrix protein (3-15) [Zaire ebolavirus]
<p>Matrix protein (3-15) links viral envelope to ebolavirus core; part of EBOV, a Filoviridae causing fatal hemorrhagic fevers.</p>Formula:C69H110N16O20SPurity:98%Color and Shape:SolidMolecular weight:1515.77ACTH (22-39) acetate
<p>ACTH (22-39) acetate is a fragment of adrenocorticotropic hormone (ACTH) containing two proline residues at positions 3 and 15 from the N-terminus.</p>Formula:C92H129N19O34Purity:98.14%Color and Shape:SolidMolecular weight:2045.12p2Ca
CAS:<p>p2Ca, peptide from alpha-ketoglutarate dehydrogenase, pairs with MHC-I protein Ld, recognized by CTL clone 2C.</p>Formula:C47H66N8O12Purity:98%Color and Shape:SolidMolecular weight:935.07Pep1-AGL
<p>Analog of Pep1-TGL</p>Formula:C40H69N11O14SPurity:98%Color and Shape:SolidMolecular weight:960.11SPR741 TFA (1179330-52-9 free base)
<p>SPR741 TFA (NAB741 TFA) is a cationic peptide derived from polymyxin B and is a potentiator molecule.</p>Formula:C46H74F3N13O15Purity:98%Color and Shape:SolidMolecular weight:1106.15β-Endorphin, equine (TFA)
<p>β-Endorphin, equine (TFA) is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors.</p>Formula:C156H249F3N42O46SPurity:98%Color and Shape:SolidMolecular weight:3537.96[Arg8]-Vasotocin TFA (113-80-4 free base)
<p>[Arg8]-Vasotocin (TFA) is a nonmammalian vertebrate neurohypophyseal peptide.</p>Formula:C45H68F3N15O14S2Purity:98%Color and Shape:SolidMolecular weight:1164.24Osteogenic Growth Peptide (10-14) acetate
<p>Osteogenic Growth Peptide (10-14) acetate (Osteogenic Growth Peptide) is a Src inhibitor and an effective mitogen and stimulator of osteogenesis and</p>Formula:C26H33N5O9Purity:98.69%Color and Shape:SolidMolecular weight:559.57Acv tripeptide
CAS:<p>Acv tripeptide is a crucial precursor in penicillin and cephalosporin biosyntheses.</p>Formula:C14H25N3O6SPurity:98%Color and Shape:SolidMolecular weight:363.43AtPep3 TFA (902781-14-0 free base)
<p>AtPep3 TFA is a hormone-like peptide that plays a role in the salinity stress tolerance of plants.</p>Formula:C104H179N36F3O34Purity:98%Color and Shape:SolidMolecular weight:2534.75Proadrenomedullin (45-92), human
CAS:<p>Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM.</p>Formula:C215H359N67O73S2Purity:98%Color and Shape:SolidMolecular weight:5114.76Amyloid Precursor C-Terminal Peptide
<p>Amyloid precursor peptide involved in Alzheimer's forms plaques; sequence Gly-Tyr-Glu-Asn-Pro-Thr-Y-Lys-Phe-F-Glu-Gln-M-Gln-Asn. Linked to astrocytosis.</p>Formula:C86H118N20O27S1Purity:98%Color and Shape:SolidMolecular weight:1896.04BDC2.5 mimotope 1040-51
CAS:<p>BDC2.5 mimotope 1040-51 is an agonistic peptide for T cells in diabetic NOD mice.</p>Formula:C60H99N17O13SPurity:98%Color and Shape:SolidMolecular weight:1298.6Arfalasin
CAS:<p>Arfalasin is a bioactive chemical.</p>Formula:C48H67N13O11Purity:98%Color and Shape:SolidMolecular weight:1002.13Melittin Acetate
<p>Melittin Acetate, a PLA2 activator, enhances low-weight PLA2 activity but not high-weight PLA2.</p>Formula:C133H233N39O33Purity:99.78%Color and Shape:SoildMolecular weight:2906.51Crustacean Cardioactive Peptide (CCAP)
CAS:<p>Crustacean Cardioactive Peptide (CCAP) is a conserved modified cyclic nonapeptide primary structure of PFCNAFTGC-NH2, a disulfide bridge between Cys3 and Cys9.</p>Formula:C42H58N10O12S2Purity:95.40%Color and Shape:SolidMolecular weight:959.1Acth (7-16)NH2
CAS:<p>Acth (7-16)NH2 exhibits neurotrophic effects.</p>Formula:C58H92N18O10Purity:98%Color and Shape:SolidMolecular weight:1201.47Sakamototide substrate peptide TFA
<p>Sakamototide substrate peptide TFA is a peptide substrate of AMPK kinase family and can be used for the determination of kinase activity.</p>Formula:C71H123F3N30O25Purity:98%Color and Shape:SolidMolecular weight:1853.92Cucumarioside C2
CAS:<p>Cucumarioside C2 is a sea cucumber glycoside.</p>Formula:C60H92O26Purity:98%Color and Shape:SolidMolecular weight:1229.37Thioctoyl tripeptide-1
CAS:<p>Thioctoyl tripeptide-1 is a peptide.</p>Formula:C22H36N6O5S2Purity:98%Color and Shape:SolidMolecular weight:528.69ACV 1
CAS:<p>Neuronal nicotinic receptor antagonist</p>Formula:C71H103N23O25S4Purity:98%Color and Shape:SolidMolecular weight:1806.98Bz-Nle-Lys-Arg-Arg-AMC
CAS:<p>Bz-Nle-Lys-Arg-Arg-AMC is a fluorescent tetrapeptide substrate for the quantitative detection of dengue virus, yellow fever virus and Zika virus NS3 protease.</p>Formula:C41H60N12O7Color and Shape:SolidMolecular weight:832.99Pteroylhexaglutamylglutamic acid
CAS:<p>Pteroylhexaglutamylglutamic acid is a pteroylpolyglutamate.</p>Formula:C49H61N13O24Purity:98%Color and Shape:SolidMolecular weight:1216.08Sarasinoside B1
CAS:<p>Sarasinoside B1 is a norlanostane-triterpenoid oligoglycoside from the Palauan marine sponge Asteropus sarasinosum.</p>Formula:C61H98N2O25Purity:98%Color and Shape:SolidMolecular weight:1259.444Nuclear pore complex protein Nup98 315-360
<p>Nuclear pore complex protein Nup98 (315-360) is the 315-360 fragment part of the nuclear pore complex (NPC) protein.</p>Formula:C190H288N50O64SPurity:98%Color and Shape:SolidMolecular weight:4328.68JTP10-△-TATi TFA
<p>JTP10-△-TATi TFA is a selective inhibitor of JNK2 peptide (IC50: 92 nM), exhibiting 10-fold selectivity for JNK2 over JNK1 and JNK3.</p>Formula:C120H213F3N48O28Purity:98%Color and Shape:SolidMolecular weight:2833.28pep2-EVKI
CAS:<p>Peptide inhibits GluA2-PICK1 binding, sparing GluA2-GRIP/ABP interaction and LTD, without boosting AMPA current.</p>Formula:C62H95N13O19Purity:98%Color and Shape:SolidMolecular weight:1326.51C-Reactive Protein (CRP) (201-206)
CAS:<p>C-Reactive Protein (CRP) (201-206) is the peptide fragment of C-Reactive Protein. CRP is a cardiovascular risk marker and may promote atherogenesis.</p>Formula:C38H57N9O8Purity:98%Color and Shape:SolidMolecular weight:767.91S Tag Peptide
CAS:<p>S Tag Peptide is a 15 amino acid peptide derived from RNase A.</p>Formula:C73H117N23O25SPurity:98%Color and Shape:SolidMolecular weight:1748.91InsB 9-23
<p>InsB (9-23) is an insulin B-chain peptide that binds to a class II histocompatibility complex (MHC) allele called I-Ag7.</p>Formula:C72H116N20O22S1Purity:98%Color and Shape:SolidMolecular weight:1645.9Stromatoxin 1
CAS:<p>Stromatoxin 1, a peptide isolated from tarantulas, acts as an inhibitor of various potassium channels, including K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3.</p>Formula:C156H237N49O48S7Purity:98%Color and Shape:SolidMolecular weight:3791.31Allatostatin II
CAS:<p>Allatostatin II is an Inhibitors of juvenile hormone synthesis in insects.</p>Formula:C49H74N14O13Purity:98%Color and Shape:SolidMolecular weight:1067.2Ac-AAVALLPAVLLALLAP-LEHD-CHO
CAS:<p>Ac-AAVALLPAVLLALLAP-LEHD-CHO is a caspase inhibitor targeting caspases 4, 5, and 9, demonstrating protective effects in MCF-7 cells treated with</p>Formula:C97H162N22O25Purity:98%Color and Shape:SolidMolecular weight:2036.46HIF-1 α (556-574) TFA (1201633-99-9 free base)
<p>19-mer HIF-1α fragment critical for oxygen response; binds VHL via crucial proline 564 for gene regulation.</p>Formula:C103H151D2F3N20O36S2Purity:98%Color and Shape:SolidMolecular weight:2368.62TAT 14
CAS:<p>TAT 14: a 14-mer peptide Nrf2 activator, anti-inflammatory, boosts Nrf2 protein, targets Keap1, no effect on mRNA.</p>Formula:C137H230N48O39Purity:98%Color and Shape:SolidMolecular weight:3173.59TAK-683 TFA (872719-49-8 free base)
<p>TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.</p>Formula:C66H84F3N17O15Purity:98%Color and Shape:SolidMolecular weight:1412.47LSKL TFA
CAS:<p>LSKL TFA (H-Leu-Ser-Lys-Leu-NH2 TFA) is a TGF-尾1 antagonist that inhibits TSP-1 binding to LAP and reduces renal interstitial fibrosis and liver fibrosis.</p>Formula:C23H43F3N6O7Purity:99.33%Color and Shape:SolidMolecular weight:572.62Jingzhaotoxin-34
<p>Jingzhaotoxin-34, a 35-residue neurotoxic polypeptide, selectively inhibits tetrodotoxin-sensitive (TTX-S) sodium currents in rat dorsal root ganglion neurons</p>Formula:C154H219N39O45S7Purity:98%Color and Shape:SolidMolecular weight:3561.08Antho-rpamide II
CAS:<p>Antho-rpamide II is a biologically active neuropeptide isolated from the sea anemone Anthopleura elegantissima.</p>Formula:C41H60N14O9Purity:98%Color and Shape:SolidMolecular weight:893Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated)
CAS:<p>Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated) is a hirugen-like peptide with greater thrombin affinity than Hirugen, exhibiting a dissociation constant (K</p>Formula:C64H88N10O26SPurity:98%Color and Shape:SolidMolecular weight:1445.5ω-Conotoxin CnVIIA
CAS:<p>ω-Conotoxin CnVIIA, a 27-amino-acid neuropeptide toxin, serves as an N-type calcium current blocker [1].</p>Formula:C110H179N39O36S7Purity:98%Color and Shape:SolidMolecular weight:2848.29PKCθ pseudosubstrate peptide inhibitor,myristoylated
<p>Myristoylated PKCθ pseudosubstrate peptide inhibitor is a synthetic peptide utilized to investigate the mechanism of action of protein kinase C theta (PKCθ) [1</p>Formula:C105H184N36O21SPurity:98%Color and Shape:SolidMolecular weight:2318.88ɛPKC(85-92),Myristoylated
CAS:<p>PKC(85-92)，Myristoylated is a myristic acid-conjugated, cell-permeable peptide activator of PKC that has been shown to increase nitric oxide (NO) release in</p>Formula:C53H80N10O15Purity:98%Color and Shape:SolidMolecular weight:1097.26ProTx-III
<p>ProTx-III, a spider venom peptide derived from the Peruvian green velvet tarantula, functions as a selective and potent inhibitor of the voltage-gated sodium</p>Formula:C162H246N52O43S6Purity:98%Color and Shape:SolidMolecular weight:3802.4BM213
CAS:<p>BM213 is a useful organic compound for research related to life sciences and the catalog number is T35399.</p>Formula:C43H70N12O10Purity:98%Color and Shape:SoildMolecular weight:915.09Spinoxin
CAS:Spinoxin, a 34-residue peptide neurotoxin extracted from the venom of Heterometrus spinifer, is characterized by four disulfide bridges.Formula:C147H236N48O46S9Purity:98%Color and Shape:SolidMolecular weight:3700.33γ-1-MSH, amide
<p>Gamma-MSH (Melanocyte Stimulating Hormone), a putative hormone in the N-terminal region of the ACTH/beta- endorphin (beta-EP) precursor protein, was studied by</p>Formula:C72H97N21O14SPurity:98%Color and Shape:SolidMolecular weight:N/AFOR-MET-PHE-OH acetate
<p>FOR-MET-PHE-OH acetate increases significantly granulocyte adhesiveness when used at a concentration chemotactically effective.</p>Formula:C17H24N2O6SPurity:99.81%Color and Shape:SolidMolecular weight:384.45Smcy HY Peptide (738-746)
CAS:<p>Smcy HY Peptide (738-746) is an H2-Db-restricted peptide, derived from the amino acid sequence 738 to 746 of the Smcy protein.</p>Formula:C48H82N18O14SPurity:98%Color and Shape:SolidMolecular weight:1167.34µ-Conotoxin GIIIB
CAS:<p>μ-Conotoxin GIIIB, a 22-residue polypeptide derived from the venom of the piscivorous cone snail Conus geographus, serves as an inhibitor of the Na V 1.4</p>Formula:C101H175N39O30S7Purity:98%Color and Shape:SolidMolecular weight:2640.17GRGDSPC
CAS:<p>GRGDSPC: 7-AA thiolated peptide; non-viral gene vector; easy synthesis; high efficiency; low toxicity.</p>Formula:C25H42N10O11SPurity:98%Color and Shape:SolidMolecular weight:690.73Leu-Val
CAS:<p>Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.</p>Formula:C11H22N2O3Purity:97.72%Color and Shape:SolidMolecular weight:230.3FITC-β-Ala-β-Amyloid (25-35)
<p>FITC-β-Ala-β-Amyloid (25-35) is a FITC-labeled fluorescent compound utilized in Alzheimer's disease research [1].</p>Color and Shape:Odour SolidConotoxin GII
CAS:<p>Conotoxin GII is a highly toxic peptide.</p>Formula:C57H81N19O16S4Purity:98%Color and Shape:SolidMolecular weight:1416.63type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
<p>Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).</p>Formula:C47H77N13O15Purity:98%Color and Shape:SolidMolecular weight:1064.19PUMA BH3 (TFA)
<p>PUMA BH3 (TFA) is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.</p>Formula:C130H203F3N42O45SPurity:98%Color and Shape:SolidMolecular weight:3163.32Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Purity:98%Color and Shape:SolidMolecular weight:3692.15Preprosomatostatin (25-34)
CAS:<p>Preprosomatostatin (25-34) is a peptide.</p>Formula:C52H83N17O15Purity:98%Color and Shape:SolidMolecular weight:1186.32Acein
<p>ACE ligand with Kd of 2.79 nM; doesn't affect ACE activity ≤500 nM; boosts dopamine release in striatum via NMDA + D-serine.</p>Formula:C43H68N10O13Purity:98%Color and Shape:SolidMolecular weight:932.5CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formula:C162H262N50O52S2Purity:98%Color and Shape:SolidMolecular weight:3806.3OVA sequence (323-336)
CAS:<p>This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencity</p>Formula:C63H100N20O22Purity:98%Color and Shape:SolidMolecular weight:1489.59Biotin-myelin basic protein (94-102)
CAS:<p>Biotin-myelin basic protein (94-102) is a peptide fragment crucial for myelin adhesion within the nervous system, facilitating myelination.</p>Formula:C49H84N20O13SColor and Shape:SolidMolecular weight:1193.38MMK 1 acetate
<p>MMK 1 acetate is an agonist of formyl peptide receptor 2 (FPR2), which was previously known as formyl peptide receptor-like 1 (FPRL1) [1].</p>Formula:C77H127N19O20SPurity:99.11%Color and Shape:SolidMolecular weight:1671.01D-Lys(Z)-Pro-Arg-pNA
CAS:<p>D-Lys(Z)-Pro-Arg-pNA is a luminescent substrate of activated protein C (APC).</p>Formula:C31H43N9O7Purity:98%Color and Shape:SolidMolecular weight:653.73H-Asp(AMC)-OH
CAS:<p>H-Asp(AMC)-OH, an amino acid derivative and fluorescent dye, does not inhibit glycine transport at a concentration of 0.25 mM [1].</p>Formula:C14H14N2O5Color and Shape:SolidMolecular weight:290.27Pandinotoxin Kα
CAS:<p>Pandinotoxin Kα, a chemical compound extracted from the emperor scorpion (Pandinus imperator) venom, functions as an inhibitor of the A-type potassium channel [</p>Formula:C169H267N53O48S7Purity:98%Color and Shape:SolidMolecular weight:4033.71Caloxin 3A1
<p>Caloxin 3A1, a biologically active peptide, is a member of the caloxins, which are inhibitors of the extracellular plasma membrane (PM) Ca2+ pumps.</p>Formula:C83H126N22O30Purity:98%Color and Shape:SolidMolecular weight:1912.02MRS 2957 triethylammonium salt
CAS:<p>MRS 2957 triethylammonium salt is a P2Y6 agonist.</p>Formula:C19H28N5O20P3Purity:98%Color and Shape:SolidMolecular weight:739.37Z-Leu-Leu-Tyr-COCHO
CAS:<p>Z-Leu-Leu-Tyr-COCHO is a potent inhibitor of chymotrypsin-like activity, exhibiting a Ki value of 3.0 nM [1].</p>Formula:C30H39N3O7Purity:98%Color and Shape:SolidMolecular weight:553.65REDV TFA
<p>REDV TFA, the minimal active sequence of the CS5 site in the alternatively spliced type III connecting segment (IIICS) of fibronectin, mediates adhesion to the</p>Formula:C20H35N7O9·xC2HF3O2Purity:98%Color and Shape:SolidMolecular weight:517.53 (free acid)Vm24-toxin
CAS:<p>Vm24-toxin, a peptide toxin isolated from the Mexican scorpion Vaejovis mexicanus smithi, serves as an inhibitor of the Kv1.3 potassium channel [1].</p>Formula:C157H253N51O45S9Purity:98%Color and Shape:SolidMolecular weight:3863.59NP213 TFA (942577-31-3 free base)
<p>NP213 TFA: first synthetic AMP with fast-acting anti-fungal action, disrupts fungal membranes.</p>Formula:C44H85F3N28O9Purity:98%Color and Shape:SolidMolecular weight:1207.32Z-Pro-Pro-aldehyde-dimethyl acetal
CAS:<p>Z-Pro-Pro-aldehyde-dimethyl acetal is a potent prolyl endopeptidase (PREP) inhibitor, effectively impeding the activity of this cytoplasmic serine endoprotease</p>Formula:C20H28N2O5Purity:98%Color and Shape:SolidMolecular weight:376.45Prepro VIP (111-122), human
CAS:<p>Prepro VIP (111-122), human is a prepro-vasoactive intestinal polypeptide (VIP)–derived peptide, corresponding to residues 111-122.</p>Formula:C53H87N13O21Purity:98%Color and Shape:SolidMolecular weight:1242.33H-β-Ala-AMC TFA
CAS:<p>H-β-Ala-AMC TFA is a substrate for aminopeptidase. Building block for synthesizing the fluorogenic vanin I substrate pantothenate-AMC.</p>Formula:C15H15F3N2O5Purity:99.47%Color and Shape:SolidMolecular weight:360.29SPACE peptide
<p>SPACE peptide is a skin penetrating peptide that facilitates the transfer of molecules through the skin.</p>Formula:C40H63N15O17S2Purity:98%Color and Shape:SolidMolecular weight:1090.17GRP (porcine)
CAS:<p>GRP: agonist for GRPR, stimulates amygdala GABA release reducing fear in mice, aids mitogenesis, GI function, and appetite control.</p>Formula:C126H198N38O31S2Purity:98%Color and Shape:SolidMolecular weight:2805.31Ige octapeptide (497-504)
CAS:<p>Ige octapeptide (497-504) is a bioactive chemical.</p>Formula:C41H63N11O10Purity:98%Color and Shape:SolidMolecular weight:870.01Flagelin 22 TFA (304642-91-9 free base)
<p>Flagelin 22 TFA (Flagellin 22 TFA), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.</p>Formula:C95H163F3O36N32Purity:98%Color and Shape:SolidMolecular weight:2386.53Biotin-Crosstide TFA
<p>Biotin-crosstide is a derivative of the peptide Akt substrate crosstide, featuring biotinylation.</p>Formula:C58H91N19O19S·XCF3COOHColor and Shape:SolidMolecular weight:1390.53PKC-ε translocation inhibitor peptide
<p>PKC-ε Translocation Inhibitor Peptide is a selective modulator that controls the FcγR-mediated internalization rate of opsonized beads without affecting FcαR</p>Purity:98%Color and Shape:Odour SolidAdrenomedullin (AM) (1-52), human
CAS:<p>Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.</p>Formula:C264H406N80O77S3Purity:98%Color and Shape:SolidMolecular weight:6028.82immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
<p>Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.</p>Formula:C54H83N13O13Purity:98%Color and Shape:SolidMolecular weight:1122.32RYTVELA TFA
CAS:<p>RYTVELA TFA is a variant interleukin-1 receptor inhibitor with anti-inflammatory activity for the prevention of preterm labor and fetal protection.</p>Formula:C38H62N10O12Color and Shape:SolidMolecular weight:850.96Fibrinogen Binding Inhibitor Peptide
CAS:<p>Synthetic dodecapeptide mimics human fibrinogen g-chain, inhibits platelet receptor (residues 400-411).</p>Formula:C50H80N18O16Purity:98%Color and Shape:SolidMolecular weight:1189.28Mas7
CAS:<p>Amphiphilic peptide Mas7, a structural analogue of mastoparan is a known activator of heterotrimeric Gi-proteins and its downstream effectors.</p>Formula:C67H124N18O15Purity:98%Color and Shape:SolidMolecular weight:1421.81Cucumarioside H
CAS:<p>Cucumarioside H is a triterpene glycoside</p>Formula:C60H92O29SPurity:98%Color and Shape:SolidMolecular weight:1309.43Biotin-SRC-1 (676-700) TFA
<p>Biotin-SRC-1 (676–700), a biotinylated and truncated variant of steroid receptor coactivator 1 (SRC-1), finds application in affinity-based reporter assays such</p>Formula:C128H209N41O40S2·XCF3COOHColor and Shape:SolidMolecular weight:3026.41S-palm P0(180-199) TFA
<p>S-palm P0(180–199) (TFA) is a peptide that enhances MHC II-restricted responses. It is utilized to develop models of chronic inflammatory demyelinating polyradiculoneuropathy (CIDP) and chronic experimental autoimmune neuritis (c-EAN). S-palm P0(180–199) (TFA) is also studied in the context of autoimmune-mediated neuritis.</p>Formula:C112H191N33O29S2·xC2HF3O2Color and Shape:SolidMolecular weight:2528.05 (free base)Lqvtdsglyrcviyhpp TFA
<p>Lqvtdsglyrcviyhpp TFA is a TREM-1 inhibitor with potential anticancer activity and can be used to study skin and pancreatic cancer.</p>Formula:C91H138F3N23O27SPurity:95%Color and Shape:SolidMolecular weight:2075.27Antennapedia Peptide FAM-labeled
<p>Antennapedia Peptide FAM-labeled, a fluorophore-tagged peptide, functions as a molecular probe in cancer research [1].</p>Color and Shape:Odour SolidRink Amide MBHA resin (100 - 200 mesh); loading 0.54 mmol/g
CAS:Color and Shape:White to light-yellow or beige beadsMolecular weight:-5(6)-CR110 [5-(and 6)-Carboxyrhodamine 110] *Mixed isomers*
<p>5(6)-CR110 [5-(and 6)-Carboxyrhodamine 110] *Mixed isomers* is a Fluorescein for peptide and oligonucleotide labeling.</p>Formula:C21H15N2O5ClPurity:98%Color and Shape:SolidMolecular weight:410.81Acetyl tetrapeptide-9
CAS:Acetyl tetrapeptide-9 is important for the stimulation of basement membrane polysaccharide (lumican) and the synthesis of collagen I.Formula:C22H33N7O9Purity:98%Color and Shape:SolidMolecular weight:539.54PEN(mouse) acetate
<p>PEN(mouse) acetate (proSAAS(221-242) Acetate) (1236955-25-1 Free base) is a polypeptide derivative.</p>Formula:C104H173N27O36Purity:99.64%Color and Shape:SoildMolecular weight:2377.65Leucokinin I acetate
<p>Leucokinin I acetate is an antiserum raised against an insect myotropic peptide.</p>Formula:C43H57N11O14Purity:98.02%Color and Shape:SolidMolecular weight:951.98α-Factor Mating Pheromone, yeast
CAS:<p>Alpha factor mating pheromone is a peptide of 13 amino acids secreted by Saccharomyces cerevisiae α cells.</p>Formula:C82H114N20O17SPurity:98%Color and Shape:White PowderMolecular weight:1684Cathepsin D and E FRET Substrate acetate
<p>Fluorogenic substrate for cathepsins D & E, not B/H/L; useful in their mechanistic studies.</p>Formula:C86H124N22O21Purity:95.63%Color and Shape:SolidMolecular weight:1802.04Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens]
<p>IGHM fragment [Homo sapiens]: Part of B-cell antigen recognition; 2 heavy, 2 light chains; contains antigen-binding site.</p>Formula:C82H132N24O20Purity:98%Color and Shape:SolidMolecular weight:1774.07Neuropeptide Y (scrambled)
<p>NPY: a 36-amino acid neuropeptide, affects vasoconstriction, memory, appetite, and circadian rhythm via G-protein receptors in nervous systems.</p>Formula:C190H287N55O57Purity:98%Color and Shape:SolidMolecular weight:4253.7Trifluoroacetic acid, Ultrapure for synthesis
CAS:Formula:CF3CO2HPurity:≥ 99.80%Color and Shape:Clear, colourless to faint yellow liquidMolecular weight:114.02PIC1 PA
CAS:<p>PIC1 PA, a peptide consisting of 15 amino acids, serves as an effective analog of PIC1 that inhibits complement activation mediated by the classical pathway. Functionally, PIC1 PA interferes with the interaction between the C1s-C1r-C1r-C1s/MASPs and the collagen-like region (CLR) of C1q/MBL. It specifically binds to the CLR of C1q, with an average equilibrium dissociation constant (KD) of 33.3 nM when binding purified C1q.</p>Formula:C71H123N19O21S2Color and Shape:SolidMolecular weight:1642.98Magainin 1 TFA (108433-99-4 free base)
<p>Magainin 1 TFA is an antimicrobial amphiphilic peptide isolated from xenopus skin.</p>Formula:C114H178N29F3O30SPurity:98%Color and Shape:SolidMolecular weight:2523.87Angiotensin 1/2 (1-8) amide
<p>Angiotensin 1/2 amide, a vasopressor and potent vasoconstrictor, treats shock and circulatory collapse.</p>Formula:C50H72N14O11Purity:98%Color and Shape:SolidMolecular weight:1045.19Tetrapeptide-3
CAS:<p>Tetrapeptide-3 is a bioactive chemical.</p>Formula:C20H37N9O4Purity:98%Color and Shape:SolidMolecular weight:467.57heparin cofactor II precursor fragment [Homo sapiens]
<p>Heparin cofactor II precursor fragment [Homo sapiens] is a peptide with the sequence H2N-Tyr-Glu-Ile-Thr-Thr-Ile-His-Asn-Leu-Phe-Arg-OH, MW=1406.58.</p>Formula:C65H99N17O18Purity:98%Color and Shape:SolidMolecular weight:1406.58T7 Tag Peptide
CAS:<p>T7 Tag Peptide is a tagged protein that can be recognised by T7 tag tag antibodies and can be used in different immunoassays as well as affinity purification.</p>Formula:C41H71N13O16S3Purity:99.78%Color and Shape:SolidMolecular weight:1098.28p21PBP
<p>p21PBP, a peptide composed of 20 amino acids, serves as an inhibitor of DNA replication. It specifically binds to the purified proliferating cell nuclear antigen (PCNA) found in extracts from tumor cells. p21PBP holds potential for use in cancer research.</p>Formula:C112H181N37O30SColor and Shape:SolidMolecular weight:2557.93α1BAla
CAS:<p>alpha1BAla is a partially alpha-helical peptide.</p>Formula:C70H121N21O25SPurity:98%Color and Shape:SolidMolecular weight:1688.9Myristoyl tripeptide-1
CAS:<p>Myristoyl tripeptide-1 is a peptide.</p>Formula:C28H50N6O5Purity:98%Color and Shape:SolidMolecular weight:550.73YRGDS Fibronectin Fragment
CAS:<p>This is a fibronectin fragment, an adhesion peptide that displays strong binding affinity to thrombin-stimulated platelets. It is RGD consisting of sequence.</p>Formula:C24H36N8O10Purity:98%Color and Shape:SolidMolecular weight:596.59N-Oleoyl Glutamine
CAS:<p>N-Oleoyl Glutamine (Oleoyl-L-glutamine) antagonizes TRPV1 of the transient receptor potential (TRP) calcium channel.</p>Formula:C23H42N2O4Purity:99.61%Color and Shape:SolidMolecular weight:410.59Peptide C105Y
CAS:<p>C105Y, a synthetic peptide mimicking alpha1-antitrypsin residues 359-374, boosts DNA nanoparticle gene expression.</p>Formula:C97H148N20O23SPurity:98%Color and Shape:SolidMolecular weight:1994.4α-Gliadin (43-49)
CAS:<p>alpha-Gliadin (43-49) is a Gliadian sequence peptide. It could induce leukocyte migration inhibition but be blocked by naloxone.</p>Formula:C43H57N9O11Purity:98%Color and Shape:SolidMolecular weight:875.97Proinsulin C-Peptide (55-89), human
CAS:<p>Proinsulin, insulin's precursor, has A and B chains linked by a 31 amino acid C-peptide. Enzymes cleave it, yielding insulin and C-peptide.</p>Formula:C153H259N49O52Purity:98%Color and Shape:SolidMolecular weight:3616.99Gastrin I (1-14), human TFA
<p>Gastrin I (1-14), human TFA is 1-14 fragment of human gastrin I peptide.</p>Formula:C81H101N16F3O29Purity:98%Color and Shape:SolidMolecular weight:1819.75N,N''-Carbonyldiimidazole
CAS:Formula:C7H6N4OPurity:(Titration) ≥ 97.0%Color and Shape:White, off-white or pale yellow powder or crystalsMolecular weight:162.15Leu-Leu methyl ester hydrobromide
CAS:Formula:C13H26N2O3·HBrPurity:(TLC) ≥ 99.0%Color and Shape:White powderMolecular weight:339.27SVS-1 peptide
CAS:<p>SVS-1 peptide is an anticancer peptide that selectively targets cancer cells through electrostatic interactions, disrupting the cell membrane structure and inducing cell death. Unlike antimicrobial peptides, the activity of SVS-1 peptide occurs before the complete neutralization of membrane charges.</p>Formula:C97H183N27O19Color and Shape:SolidMolecular weight:2031.66Endo-1,3-β-glucanase
CAS:<p>Endo-1,3-β-glucanase (Lyticase) is a glucanase from fungi and Chlamydomonas reinhardtii that displays lytic activity on fungal cells.</p>Color and Shape:SolidTpp-CAQK
<p>Tpp-CAQK, a specially engineered mitochondrial compound, has been shown to improve phagocytosis of myelin debris by macrophages, reduce mitochondrial dysfunction and pro-inflammatory features, and enhance tissue repair and functional recovery in mice after spinal cord injury.</p>Formula:C40H54BrN6O7PSColor and Shape:SolidMolecular weight:873.84Arginase
CAS:<p>Arginase (L-Arginine amidinase) is a key hydrolytic enzyme in the urea cycle, which hydrolyzes L-arginine into urea and L-ornithine.</p>Color and Shape:SolidPepinh-MYD
CAS:<p>Pepinh-MYD, a MyD88 inhibitor, incorporates both a domain sequence from MyD88 TIR and a protein transduction sequence to facilitate cell membrane penetration. This compound disrupts MyD88-mediated TLR signaling pathways, effectively inhibiting associated immune responses. Its design is particularly useful for investigating MyD88's function in viral infections.</p>Formula:C151H248N50O35S2Color and Shape:SolidMolecular weight:3388.03PACE4 Inhibitory peptide C23
CAS:<p>PACE4 Inhibitory peptide C23 (Compound C23) is an effective peptidomimetic inhibitor known to act against PACE4. It exhibits antiproliferative effects on PCa cell lines, with a Ki of 5 nM, and IC50 values of 25 μM and 40 μM for DU145 and LNCaP cells, respectively. Additionally, PACE4 Inhibitory peptide C23 suppresses tumor growth in LNCaP xenograft mice.</p>Formula:C51H90N14O8Color and Shape:SolidMolecular weight:1027.35Ziconotide TFA (107452-89-1 free base)
<p>Ziconotide TEA blocks N-type calcium channels on pain pathway neurons, dampening synapse activity and providing strong pain relief.</p>Formula:C116H179F21N36O46S7Purity:98%Color and Shape:SolidMolecular weight:3437.36-FAM-AEEAC-SHK TFA
<p>6-FAM-AEEAC-SHK TFA, a peptide neurotoxin derived from Stichodactyla helianthus and conjugated with a fluorescent marker, selectively blocks voltage-gated potassium channels (kv1.1 and kv1.2). By prolonging action potentials, it interferes with neural signal conduction, making it valuable in neuroscience research.</p>Formula:C196H295N55O57S7·xCHF3O2Color and Shape:SolidMolecular weight:4558.23 (free acid)Cyclo(Arg-Pro) TFA
<p>Cyclo(Arg-Pro) TFA, also known as Cyclo(Pro-Arg) TFA, serves as an inhibitor of chitinase. This compound impedes the cell separation of Saccharomyces cerevisiae without affecting its growth. Additionally, Cyclo(Arg-Pro) TFA inhibits the morphological transition of Candida albicans from a yeast form to a filamentous form.</p>Formula:C13H20F3N5O4Color and Shape:SolidMolecular weight:367.32TKD (450-463)
CAS:<p>TKD (450-463), a 14-peptide (TKDNNLLGRFELSG), exhibits the ability to stimulate NK cells' cytolytic and proliferative activities at concentrations comparable to the full-length Hsp70 protein.</p>Formula:C67H110N20O23Color and Shape:SolidMolecular weight:1563.71Phytochelatin 4
CAS:<p>Phytochelatin 4 (PC 4) a heavy metal detoxifier/chelator consisting of 4 units of glu - cys , tolerant to Cd (cadmium), ultimately sequestered in the vesicle.</p>Formula:C34H53N9O18S4Purity:95.98%Color and Shape:SolidMolecular weight:1004.09Ac-LETD-AFC
CAS:<p>Ac-LETD-AFC is a fluorescent substrate that can be specifically cleaved by caspase-8. λEx(nm) of Ac-LETD-AFC is 400 nm and λEm is 505 nm.</p>Formula:C31H38F3N5O12Purity:99.67%Color and Shape:SolidMolecular weight:729.65Substance P(1-4) Acetate
<p>Substance P(1-4) Acetate is a neurokinin receptor (NK-R) antagonist, inhibiting the formation of PV EEC.</p>Formula:C24H44N8O7Purity:99.84%Color and Shape:SolidMolecular weight:556.66Ac-FEID-CMK TFA
<p>Ac-FEID-CMK TFA is a zebrafish GSDMEb-derived peptide inhibitor that acts by inhibiting the caspy2-mediated atypical inflammatory vesicle pathway.</p>Formula:C29H38ClF3N4O11Purity:95%Color and Shape:SolidMolecular weight:711.08Obestatin (human)
CAS:<p>Obestatin (human) is an endogenous ligand for G-protein eurythmic entity 39 formed by shearing of preproghrelin and can be used to study obesity.</p>Formula:C116H176N32O33Purity:99.75%Color and Shape:SolidMolecular weight:2546.83Somatostatin 1-28
CAS:<p>Somatostatin receptor agonist, derived from the post-translational cleavage of prosomatostatin.</p>Formula:C137H207N41O39S3Purity:98%Color and Shape:SolidMolecular weight:3149Peptide M
CAS:<p>Peptide M is a synthetic Peptide, 50 aa, derived from streptococcus M protein, containing an additional c-terminal cysteine residue.</p>Formula:C81H141N21O31Purity:98%Color and Shape:SolidMolecular weight:1905.11H-Lys-Trp-Lys-OH acetate
<p>H-Lys-Trp-Lys-OH acetate is a peptide with antibacterial and antiviral activities.</p>Formula:C25H40N6O6Purity:99.50%Color and Shape:SolidMolecular weight:520.62Foxy-5 Ammonium Salt
<p>Foxy-5 Ammonium Salt, a WNT5A mimetic, blocks epithelial cancer cell migration without β-catenin impact and curbs prostate cancer spread.</p>Formula:C26H46N7O12S2Purity:97.70%Color and Shape:SolidMolecular weight:712.26α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]
<p>Protease inhibitor</p>Formula:C51H85N11O12SPurity:98%Color and Shape:SolidMolecular weight:1076.35Neuropeptide S (human) (TFA)
<p>Neuropeptide S human (TFA) is a potent endogenous neuropeptide S receptor agonist (EC50=9.4 nM).</p>Formula:C95H156N31F3O30SPurity:98%Color and Shape:SolidMolecular weight:2301.52IP3RPEP6
CAS:<p>IP3RPEP6 serves as a competitive inhibitor of IP3R. Its IC50 values for IP3R1, IP3R2, and IP3R3 are 9.0 μM, 3.9 μM, and 4.3 μM, respectively. This compound does not affect ryanodine receptors and Cx43 hemichannels, and it is capable of modulating intracellular calcium signaling.</p>Formula:C49H79N15O24Color and Shape:SolidMolecular weight:1262.24
![MAP kinase fragment [Multiple species]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2269.webp&w=3840&q=75)
![egg white lysozyme (19-36) [Gallus gallus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2244.webp&w=3840&q=75)
![[SER140]-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1312.webp&w=3840&q=75)
![Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2238.webp&w=3840&q=75)
![matrix protein (3-15) [Zaire ebolavirus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2184.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2260.webp&w=3840&q=75)
![heparin cofactor II precursor fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2255.webp&w=3840&q=75)
![α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2216.webp&w=3840&q=75)
