Peptides

<p>Applications Poly(ethylene Glycol) molecules of an average molecular mass of 600. Poly(ethylene Glycol) is used in various applications from industrial chemistry to biological chemistry. Recent research has shown PEG maintains the ability to aid the spinal cord injury recovery process, helping the nerve impulse conduction process in animals. In rats, it has been shown to aid in the repair of severed sciatic axons, helping with nerve damage recovery. It is industrially produced as a lubricating substance for various surfaces to reduce friction. PEG is also used in the preparation of vesicle transport systems in with application towards diagnostic procedures or drug delivery methods.<br>References Borgens, R. et al.: J. Neurosci. Res., 66, 1179 (2001); Stavisky, R. et al.: Neurosci. Lett., 376, 98 (2005); Nalam, P. et al.: Tribiol. Lett., 37, 541 (2010); Steinmetz, N. et al.: J. Am. Chem. Soc., 131, 17093 (2009); Li, X. et al.: J. Am. Chem. Soc., 133, 11147 (2011); Li, L. et al.: Int. J. Pharm., 447, 192 (2013);<br></p>

<p>Stability Hygroscopic<br>Applications H-ALA-ASP-OH (cas# 20727-65-5) is a useful research chemical.<br></p>

<p>Stability Hygroscopic<br>Applications This compound is an impurity in the synthesis of Antazoline (A678405) which acts as a histamine H1 receptor blocker, functioning as an antihistamine pharmaceutical.<br>References Constanti, A. et al.: Brit. J. Pharmacol. 58, 583 (1976);<br></p>

<p>Applications Poly(ethylene Glycol) molecules of an average molecular mass of 6000. Poly(ethylene Glycol) is used in various applications from industrial chemistry to biological chemistry. Recent research has shown PEG maintains the ability to aid the spinal cord injury recovery process, helping the nerve impulse conduction process in animals. In rats, it has been shown to aid in the repair of severed sciatic axons, helping with nerve damage recovery. It is industrially produced as a lubricating substance for various surfaces to reduce friction. PEG is also used in the preparation of vesicle transport systems in with application towards diagnostic procedures or drug delivery methods.<br>References Borgens, R. et al.: J. Neurosci. Res., 66, 1179 (2001); Stavisky, R. et al.: Neurosci. Lett., 376, 98 (2005); Nalam, P. et al.: Tribiol. Lett., 37, 541 (2010); Steinmetz, N. et al.: J. Am. Chem. Soc., 131, 17093 (2009); Li, X. et al.: J. Am. Chem. Soc., 133, 11147 (2011); Li, L. et al.: Int. J. Pharm., 447, 192 (2013)<br></p>

<p>Applications Urolithin A is a major metabolite of ellagitannin and exhibits anti-inflammatory and antioxidant properties.<br>References Ishimoto, H., et. al.: Bioorg. Med. Chem. Lett., 21, 5901 (2011);<br></p>

<p>Applications DOTA-tris (t-Bu ester), is a Bifunctional chelator, that can be used in the preparation of gadolinium complexes as MRI blood contrast agents.<br></p>

<p>Applications N-CBZ-Glycyl-glycyl-L-arginine 7-Amido-4-methylcoumarin Hydrochloride is a fluorogenic substrate for uPA (urokinase).<br>References Zimmerman, M., et al. Proc. Natl. Acad. Sci. USA 75, 750 (1978);<br></p>

<p>Applications CA-074 methyl ester is a cell-permeable cathepsin B inhibitor.<br></p>

<p>Applications Glycyl-glycyl-glycine is used as a model peptide for studies of physicochemical parameters and molecular associations of small peptides. It is also used as a copper chelator.<br></p>

<p>Applications N-L-GAMMA-GLUTAMYL-L-LEUCINE (cas# 2566-39-4) is a useful research chemical.<br></p>

<p>Peptide LCBiot-HASARQQWEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-STDYGIFQINSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-D-Lys(Cl-Z)-OH is a synthetic peptide that has been shown to bind to the activator region of the human epidermal growth factor receptor (EGFR). It has also been shown to inhibit ion channels and activate ligand-gated ion channels. This product is a research tool for use in cell biology, pharmacology, and other life science research. Boc-D-Lys(Cl-Z)-OH can be used as an antibody or ligand for a receptor, as well as an inhibitor for protein interactions.</p>

<p>H-Ser-Phe-Leu-Leu-Arg-OH is a cyclic peptide that has been shown to have cytotoxic effects against cells of the atherosclerotic lesion in vivo. It also has antioxidant properties and can be used as a biocompatible polymer for the treatment of autoimmune disease. This drug is not potent enough to be used as an antibacterial agent but is effective against some strains of Mycobacterium tuberculosis and Mycobacterium avium complex. This drug binds to integrin receptors on cells, which may account for its low potency.</p>

<p>Boc-D-Arg(Tos)-OH is an analytical grade building block for the synthesis of D-amino acids. It is used as a reagent for the synthesis of Boc-protected D-amino acids and as a precursor to other amino acid derivatives. The chemical name is N-[2,6-diaminopimeloyl]glycine ethyl ester hydrochloride. Boc-D-Arg(Tos)-OH is soluble in ethyl acetate and methanol, but not in water or ethanol. This product can be used to synthesize peptides with desired properties.</p>

<p>Boc-Ala-OH is a peptide that is used in the treatment of skin cancer. It has been shown to have antitumor properties, as well as antiviral and antifungal effects. Boc-Ala-OH has been shown to inhibit proteolytic enzymes, such as collagenase and elastase, which are involved in the development of inflammatory diseases. This peptide also binds to human serum albumin with high affinity, which may be an important factor in its therapeutic effect. Boc-Ala-OH inhibits the enzyme activities of neutrophils by binding to their membranes and changing the permeability of these cells, which causes them to release cytotoxic granule contents. This peptide also inhibits squamous cell carcinoma and other types of cancerous cells.</p>

<p>Peptide H-GLFIIDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Cyc-Biot-CGKGRGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-L^^GTL^^DNPSSL^^DETAYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>BQ-123 is a cyclic peptide that blocks the endothelin-A receptor. It has been shown to be an effective treatment for pain and inflammation associated with osteoarthritis, rheumatoid arthritis, and other inflammatory conditions. BQ-123 binds to the endothelin-A receptor, which is located on the surface of cells in many tissues throughout the body. When bound, it inhibits intracellular calcium concentrations by reducing voltage-gated calcium channels and prevents the release of neurotransmitters. BQ-123 also has a stabilizing effect on hydrogen bonds due to its charged side chains. This property may account for its ability to form stable complexes with other proteins, inhibiting their function.<br>BQ-123 has been shown to have an active binding site on cyclic AMP response element binding protein (CREB) that inhibits CREB activity, thereby reducing protein synthesis. It also blocks cyclic GMP (cGMP)-dependent protein kin</p>

<p>Ala-AMC is a fluorescent peptide that binds to the receptor AMPA and activates it. This product is used in research as a tool for studying protein interactions, cellular biology and pharmacology.</p>

<p>Colivelin is a peptide that can be found in the central nervous system. It has been shown to have a wide variety of biological activities, including being an inhibitor of neuronal death, enhancing axonal growth and proliferation, and decreasing the activity of signal pathways. Colivelin has also been shown to inhibit the proliferation of human osteosarcoma cells by binding to their cell surface receptors.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Ac-Tyr-Val-Gly is a mitochondrial protein that regulates mitochondrial functions and is involved in the regulation of apoptosis. Ac-Tyr-Val-Gly interacts with nuclear DNA and regulates transcription, translation, and replication. Ac-Tyr-Val-Gly has been shown to be toxic to liver cells; however, it has been shown to have no effect on neuronal death or apoptosis pathway. These effects may be due to its ability to induce proteolytic activity in neurons and its ability to activate proapoptotic proteins such as Bax.</p>

<p>Peptide H-LL^EAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VSFEDSVISLSGDHSIIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ILGGHLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Cys(Pam)2-OH is a building block that can be used in the synthesis of lipopeptides. It is used in the research of vaccines and has been shown to target tumor cells.</p>

<p>Peptide H-TEDTIFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DSTGSFVLPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-Gly-Arg-Gly-Glu-Ser-OH is a monoclonal antibody that binds to the integrin receptor on the surface of fibroblasts. It has been shown to inhibit the angiogenic process in vitro, by reducing the expression of growth factors β1 and VEGF. This antibody also inhibits collagen gel contraction and membrane interactions. The detection time for this antibody is approximately 5 days.</p>

<p>Peptide H-LCTP^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.</p>

<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.</p>

<p>CART is a peptide that acts as an activator for the CART receptor. It has been shown to be a ligand for the CART receptor and blocks calcium channels in cell culture. It is a potent inhibitor of ion channels, which are proteins that allow ions to pass through the membrane of cells. CART is also used as a research tool in cell biology, pharmacology, and life science.</p>

<p>Peptide H-IQAEPDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AVTSANIQEFAGCK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TIVGALIQSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GEGGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-PKKKRKVEDPYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NLVPMVATV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VV^GADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EQLSSVSSF^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-V^VGGLVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lactacystin is a peptide that acts as an activator of ion channels. It binds to the receptor and activates the ligand-gated ion channel, which then opens the ion channel. This leads to increased influx of ions into the cell and an increase in intracellular calcium concentration. Lactacystin has been used as a research tool for studies on protein interactions, such as antibody-antigen interactions and receptor-ligand interactions. Lactacystin is also used for pharmacological purposes, such as for pain relief or for treatment of epilepsy.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-SHAVSS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-EMPSEEGYQDYEPEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VLIYFTSSLHSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LFPEYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TTDGYLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-APWIEQEGPEYWDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VQII^NK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLAQTTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TPAQFDADELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-D-Glu(OBzl)-OH is a potent and selective activator of the D2 dopamine receptor. It binds to the D2 receptor with high affinity and specificity. Boc-D-Glu(OBzl)-OH will protect against D2 receptor desensitization and downregulation, which are common side effects that occur when the D2 receptor is overstimulated by other ligands. Boc-D-Glu(OBzl)-OH may also be useful as a pharmacological tool in studying the function of the D2 receptor in cell biology, cancer research, immunology, and neuropharmacology.</p>

<p>Peptide H-SFEMLILGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-SIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CRNTQLAGSSELAAE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FNVWDTAGQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EQLGEFYEALDCLCIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-MVLQNSGKFRAESRGDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Endothelin-1 (ET-1) is a peptide hormone that stimulates the release of catecholamines from the adrenal medulla, and acts as a vasoconstrictor. ET-1 is a potent activator of endothelin receptor type A (ETA), which causes vasoconstriction and bronchoconstriction. The antibody recognizes human ET-1 and does not cross react with other endothelin peptides. This antibody can be used for the detection of ET-1 in tissues or cell culture supernatants. It can also be used to purify recombinant human endothelin or ET receptor subtypes.</p>

<p>Peptide H-YNGIITETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-Leu-Glu-His-Asp-H (aldehyde) is a research tool that is used in the study of ion channels and receptor proteins. It can be used to activate a receptor or ligand, or to inhibit them. Ac-Leu-Glu-His-Asp-H (aldehyde) can also be used as an antibody to identify peptides and proteins. This product has high purity and is intended for use in pharmacology and life science research.</p>

<p>Peptide H-DLQNFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-D-Phe-OH is an antimicrobial peptide that is a small molecule with a molecular weight of 254.8. It has been shown to have anti-tumor activity, and can be used as an alternative to conventional chemotherapeutic drugs in the treatment of cancer. Boc-D-Phe-OH binds to the hydrophobic region on the surface of cells and disrupts the cell's membrane, causing cell death by apoptosis. This peptide also shows antibacterial activity against gramicidin S, which is a Gram-positive antibiotic that belongs to the polymyxins class. The antibacterial activity of this peptide may be due to its ability to bind to divalent cations such as calcium ions and magnesium ions. Boc-D-Phe-OH has been synthesized using a method that is both efficient and rapid (less than 12 hours). It has also been shown that this peptide does not show any</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-MPRHSRAKRAPRPSAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TAPI-1 is an inhibitor of TACE (TNF-α converting enzyme, also known as ADAM17) and matrix metalloproteinases (MMPs). It blocks the shedding of several cell surface proteins, including tumor necrosis factor-alpha (TNF-α), IL-6 receptor, and TNF receptors p60 (TNFRI) and p80 (TNFRII).</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide 5Fam-GPGPGPGPGPGPGPGPGPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Metastin is a peptide that activates the Kisspeptin receptor. It has been shown to inhibit protein interactions, activate ligands and receptors, and act as a research tool in cell biology. Metastin is an inhibitor of the G-protein coupled receptor, KISS1R. Metastin has been shown to activate the LGR5 receptor.</p>

<p>NPY is a peptide that belongs to the family of neuropeptides. NPY regulates appetite and energy expenditure, among other physiological processes, by binding to receptors in the brain. NPY has been shown to be an inhibitor of protein interactions, activator of ligands, and a receptor for antibodies. This peptide is synthesized in the hypothalamus as well as other parts of the central nervous system. NPY is also found in blood platelets, pancreas, and intestines.</p>

<p>Peptide H-LLDLLEGLTGQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ARTKQTARKSTG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ubenimex is a peptide-based inhibitor of aminopeptidase enzymes that act on the N-terminus of amino acid chains. It is also an inhibitor of Leucine aminopeptidase 3 (LAP3) and a potent irreversible inhibitor of Leukotriene A4 (LTA4) hydrolase. It is used in the treatment of non-alcoholic steatohepatitis. Ubenimex binds to the active site of aminopeptidases and inhibits their activity, thus preventing degradation of peptides. Ubenimex has been shown to inhibit aminopeptidase A and B, but not C or D. As a result, it prevents cleavage of the N-terminal amino acids from proteins, which may be involved in inflammatory processes. Furthermore Bestatin has been shown to exhibit antibacterial properties against P. gingivalis and F. nucleatum and is available in the salt form: Hydrochloride.</p>

<p>Peptide Biot-EEYHQTTEKNSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CISQAIPKKKKVLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VITAFNDGLNHLDSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TTPPVLDSDGSFFLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Asp(OtBu)-OH is a chemical compound that belongs to the group of modified amino acids. The synthesis of Fmoc-Asp(OtBu)-OH starts with the reaction of nicotinic acetylcholine, sodium carbonate, and chloride in trifluoroacetic acid. The product is then reacted with a disulfide bond and modified with polymerase chain and saponified. The final modification is achieved by reacting Fmoc-Asp(OtBu)-OH with messenger RNA (mRNA), which produces the desired product. Fmoc-Asp(OtBu)-OH has been shown to have minimal activity, as it does not elute from an ion exchange column under normal conditions. It also has no effect on acetylcholine release in rat hippocampal slices or on morphology when incubated in vitro for 24 hours at 37 degrees Celsius.</p>

<p>Peptide H-EFIAWLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VTSEGAGLQLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-GGRGGFGGRGGFGGRGGFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AFESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-FTDEYQLYEDIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SLAPYAQDTQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HLGGSQQLLHNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide pE-HWSYGLRPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ERAPGAPAFPLAIK^MMWNISAGSSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Myr-SIYRRGARRWRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 2Azido-GRKKRRQRRRPPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KHNLGHGHKHERDQGHGHQR-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AVGVGKSAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-RYDLGGAGMVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AATVGSLAGQPLQ^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WRQAAFVDSY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ALPAPIEKTISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-ARARARAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VAAEDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Beta-casomorphin (1-2) is a peptide that has been identified as a possible endogenous ligand for opioid receptors. It is a product of the breakdown of casomorphin, a milk protein found in dairy products such as cheese and yogurt. Beta-casomorphin (1-2) has been shown to bind to human immunodeficiency virus type 1 receptors and may play an important role in the pathogenesis of human immunodeficiency virus type 1 infection. This peptide also inhibits bacterial growth by binding to bacterial ribosomes, preventing the formation of new proteins, which leads to cell death. Beta-casomorphin (1-2) has been shown to have an inhibitory effect on blood pressure and its antihypertensive activity may be due to its ability to stimulate the release of nitric oxide from endothelial cells.</p>

<p>Peptide H-HMTEVVR^RC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EKAHDGGR^YYRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-DRVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-KIVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HQFLLTGDTQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TEGLQEALLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Met-Enkephalin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TELLPGDRDNLAIQTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CPSSHSSLTERHKILHRLLQEGSPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ASHLGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-KQL^ATKAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-WMDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-V^V^GGLVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-APPDNLPSPGGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-KYEQYIKW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AQLGDLPWQVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VEIIATMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FQTFEGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Signal transducers and activators of transcription 1 (STAT1) binding peptide. STAT1 is a biotinylated protein that contains an SH2 domain, which binds to specific phospho (pY)-containing peptide motifs. Interferon &amp;γ- (IFN&amp;γ-/type II IFN) activates STAT1 by its phosphorylation. STAT1 is a critical mediator of cytokine signalling and has been reported as a tumour suppressor in breast cancer, myeloma and leukaemia.IFN&amp;γ- is secreted by immune cells and signals through the IFN&amp;γ- receptor and downstream signalling pathways including the janus kinase (JAK)/STAT pathway. IFN&amp;γ- is a central mediator of the adaptive immune system and regulates macrophage activation to promote the expression of high levels of pro-inflammatory cytokines (Il-1β, IL-12, IL-23, and TNF-α)- production of reactive nitrogen and oxygen intermediates- promotion of CD4+ T helper 1 (Th1) cell response and strong inflammatory activity. IFN&amp;γ- inhibits viral replication and is essential for vaccine-mediated immune responses. IFN&amp;γ- signalling is usually short-lived to elicit recovery of homeostasis, including tissue repair, however IFN-&amp;γ- is elevated in severe adult asthma and is present in the airways of children with severe asthma. This indicates a key role for IFN&amp;γ- in inflammatory conditions.Peptide contains a phosphorylated tyrosine residue and an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag</p>

<p>Peptide H-ALPMHIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DFTFVCPTEI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>