Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 29634 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KLHL8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLHL8 antibody, catalog no. 70R-8348Purity:Min. 95%Azido-dPEG®4-Alcohol
CAS:Azido-dPEG®4-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®4-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Purity:Min. 95%Molecular weight:219.24 g/molNDUFS8 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFS8 antibody, catalog no. 70R-10377Purity:Min. 95%DHX9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DHX9 antibody, catalog no. 70R-4788Purity:Min. 95%MVK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MVK antibody, catalog no. 70R-3344Purity:Min. 95%Fmoc-N-Amido-dPEG®4-NHS Ester
CAS:Fmoc-N-Amido-dPEG®4-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®4-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C30H36N2O10Purity:Min. 95%Molecular weight:584.24 g/molGALT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GALT antibody, catalog no. 70R-2643
Purity:Min. 95%SETDB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SETDB2 antibody, catalog no. 70R-2104Purity:Min. 95%TOR3A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TOR3A antibody, catalog no. 70R-5464Purity:Min. 95%Z-Gly-Phe
CAS:Z-Gly-Phe is a peptide that inhibits protein synthesis by binding to the reactive site of a pancreatic enzyme. This site is normally occupied by a hydrogen bond and the compound binds to it by occupying this space, resulting in the inhibition of enzyme activity. Z-Gly-Phe has been shown to inhibit insulin-stimulated glucose uptake in rats, which may be due to its ability to bind with sodium carbonate. The binding constants of Z-Gly-Phe and its inhibitors have been determined using an analytical method that measures changes in pH. The optimum pH for Z-Gly-Phe is 8.5, which corresponds with the optimal pH for human pancreatic enzymes.Formula:C19H20N2O5Purity:Min. 95%Molecular weight:356.37 g/molCDS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CDS1 antibody, catalog no. 70R-6397Purity:Min. 95%ADAM12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ADAM12 antibody, catalog no. 70R-6059Purity:Min. 95%Arf4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Arf4 antibody, catalog no. 70R-9371
Purity:Min. 95%Integrin β 5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB5 antibody, catalog no. 70R-6842Purity:Min. 95%PARD6A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PARD6A antibody, catalog no. 70R-2600Purity:Min. 95%TMED1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMED1 antibody, catalog no. 70R-7395Purity:Min. 95%ACBD5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACBD5 antibody, catalog no. 70R-6732Purity:Min. 95%PLAT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PLAT antibody, catalog no. 70R-4058Purity:Min. 95%ZBTB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZBTB2 antibody, catalog no. 70R-8352
Purity:Min. 95%C-Peptide II (Mouse)-EIA Kit (1ea)
C-Peptide II (Mouse)-EIA Kit is a Mouse C-Peptide II (C-PEPTIDE) ELISA Kit. This kit is designed to measure the level of C-peptide in mouse serum by using a sandwich enzyme immunoassay. The assays are carried out in microtiter plates coated with monoclonal antibodies specific for mouse C-peptide. After incubation, unbound material is removed and the wells are washed. The amount of bound mouse C-peptide is then determined by adding an enzyme conjugate that reacts with the mouse C-peptide and measuring the degree of color development with a spectrophotometer.Purity:Min. 95%NDUFS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFS1 antibody, catalog no. 70R-3459Purity:Min. 95%CCDC90A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC90A antibody, catalog no. 70R-6728Purity:Min. 95%LOC202759 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC202759 antibody, catalog no. 70R-7906Purity:Min. 95%IL 5 Human
IL-5 is a cytokine that belongs to the group of hematopoietic cytokines. It is an activator of B cells and eosinophils, which are involved in the immune response to infection. IL-5 also stimulates the production of immunoglobulin E (IgE), a type of antibody that plays an important role in allergic reactions. IL-5 has been shown to inhibit ion channels and protein interactions. This molecule is a receptor for a ligand called stem cell factor, which plays an important role in the development and function of white blood cells. The CAS number for IL-5 is 57748-87-6.
Purity:Min. 95%(D-Ser4,D-Ser(tBu)6,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser4,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molSIAH1 Blocking Peptide
The SIAH1 Blocking Peptide is a high-quality product offered by Life Sciences. This peptide is commonly used in the field of Peptides and Biochemicals for its exceptional ability to neutralize TGF-beta in human serum. It contains a unique disulfide bond structure that ensures its stability and effectiveness.Purity:Min. 95%SLC6A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A2 antibody, catalog no. 70R-8519Purity:Min. 95%Plectasin
A synthetic antimicrobial peptide whose sequence is derived from the Fungus, Pseudoplectania nigrella. This product has disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39 and is available as a hydrochloride salt and as a 0.1mg vial. One letter code: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCYFormula:C189H267N53O56S7Purity:Min. 95%Molecular weight:4,401.9 g/molRRM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RRM1 antibody, catalog no. 70R-1618Purity:Min. 95%ACTL7B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACTL7B antibody, catalog no. 70R-2102
Purity:Min. 95%MAL-dPEG®4-(m-dPEG®24)3
CAS:MAL-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C23H40N4O12Purity:Min. 95%Molecular weight:564.58 g/molDMD MS Calibrator-2 (25nmol)
The dystrophin protein is encoded for by the DMD gene which when mutated can result in a muscle-wasting diseases, Becker and Duchenne muscular dystrophy. As a member of the β-spectrin/α-actinin protein family the dystrophin cytoskeletal protein has a NH2 – terminal actin binding domain and spectrin-like repeats. This product can be used as a peptide calibrator for Mass Spectroscopy research.Purity:Min. 95%ZNF385B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF385B antibody, catalog no. 70R-8995Purity:Min. 95%C1orf96 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf96 antibody, catalog no. 70R-3970Z-Leu-Leu-Nva-H (aldehyde)
CAS:Z-Leu-Leu-Nva-H (aldehyde) is a peptide that has been used as an activator and an inhibitor of ion channels. It binds to the receptor site on the ion channel, which changes the flow of ions through the channel. This peptide has been shown to inhibit ligand binding and protein interactions. Z-Leu-Leu-Nva-H (aldehyde) is a high purity product that is available in bulk amounts.
Formula:C25H39N3O5Purity:Min. 95%Molecular weight:461.60 g/molBAG6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BAG6 antibody, catalog no. 70R-10346Purity:Min. 95%SCAMP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCAMP1 antibody, catalog no. 70R-9783Purity:Min. 95%Click RWmix
Cell penetrating peptides (CPP) are a keen area of molecule design to create the ideal vector for transporting macromolecule cargo into the cell. There is also a crossover of CPP acting as antimicrobial peptides (AMP) due to their ability to permeabilise the lipid membrane. AMPs are now being considered as a tool against the rise of antibiotic-resistant bacteria. CPPs and AMPS tend to be 10 - 30 amino acids long, cationic, and rich in arginine and tryptophan. The RWR motif has been used to generate de novo CPP/AMP peptides with improved functions. Of these, RWmix was shown to have the highest cellular uptake against other RWR synthetics, the lowest cytotoxicity and significant antimicrobial activity.RWmix is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-RWmix allows a wide variety of applications particularly for conjugation, modification, and peptide design.Molecular weight:2,090.2 g/molNociceptin (Human)
CAS:Nociceptin is a peptide that binds to the NOP receptor and activates it, which inhibits neuronal activity. It has been shown to inhibit protein interactions by acting as an inhibitor of the enzyme proteasome. Nociceptin activates the Ligand-gated ion channels, which are involved in pain perception. Nociceptin also has been used as a research tool for investigating protein interactions and antibody production.
Formula:C79H129N27O22Purity:Min. 95%Molecular weight:1,809 g/molC7ORF29 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C7orf29 antibody, catalog no. 70R-3559Purity:Min. 95%BRD7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BRD7 antibody, catalog no. 70R-8303Purity:Min. 95%Onecut1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Onecut1 antibody, catalog no. 70R-7887Purity:Min. 95%DOK4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DOK4 antibody, catalog no. 70R-10015Purity:Min. 95%m-dPEG®4-Tosylate
CAS:m-dPEG®4-Tosylate is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Tosylate is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Formula:C26H44N2O13Purity:Min. 95%Molecular weight:592.63 g/molNeuroplastin Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NPTN antibody, catalog no. 70R-7282
Purity:Min. 95%HSPA4L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA4L antibody, catalog no. 70R-3945Purity:Min. 95%KCNJ1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNJ1 antibody, catalog no. 70R-5144Purity:Min. 95%PRKCB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRKCB1 antibody, catalog no. 70R-5848Purity:Min. 95%RecQL5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RECQL5 antibody, catalog no. 70R-4612ELMOD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ELMOD1 antibody, catalog no. 70R-9490Purity:Min. 95%
