Inhibidores
Los inhibidores son moléculas que se unen a enzimas, receptores u otras proteínas para reducir o bloquear su actividad biológica. Estos compuestos se utilizan ampliamente en la investigación para estudiar vías biológicas, comprender los mecanismos de las enfermedades y desarrollar fármacos terapéuticos. Los inhibidores desempeñan un papel crucial en el tratamiento de diversas enfermedades, incluyendo el cáncer, las enfermedades cardiovasculares y las infecciones. En CymitQuimica, ofrecemos una amplia gama de inhibidores de alta calidad para apoyar su investigación en bioquímica, biología celular y desarrollo farmacéutico.
Subcategorías de "Inhibidores"
- Angiogénesis(2.805 productos)
- Apoptosis(6.292 productos)
- Ciclo celular / Checkpoint(4.820 productos)
- Cromatina / Epigenética(2.490 productos)
- Señalización citoesquelética(1.544 productos)
- Daño al ADN / Reparación del ADN(2.940 productos)
- Endocrinología / Hormonas(3.706 productos)
- Enzima(3.670 productos)
- GPCR / proteína G(9.024 productos)
- Inmunología e inflamación(3.902 productos)
- Virus de la gripe(302 productos)
- Señalización JAK / STAT(417 productos)
- Señalización MAPK(1.247 productos)
- Transportador de membrana / canal de iones(3.078 productos)
- Metabolismo(10.178 productos)
- Microbiología / Virología(7.618 productos)
- Neurociencia(10.367 productos)
- Otros inhibidores(35.951 productos)
- Reducción de oxidación(41 productos)
- Señalización PI3K / Akt / mTOR(1.442 productos)
- Proteasas / Proteasoma(1.716 productos)
- Células madre y Derivados(801 productos)
- Tirosina quinasa / adaptadores(2.030 productos)
- Ubiquitinación(1.722 productos)
Mostrar 16 subcategorías más
Se han encontrado 66630 productos de "Inhibidores"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Bucetin
CAS:Bucetin (3-Hydroxy-p-butyrophenetidide) is a pharmaceutical drug that acts as an analgesic and antipyretic.Fórmula:C12H17NO3Pureza:99.60%Forma y color:SolidPeso molecular:223.27Riparin III
CAS:Riparin III is an alcamide isolated from Aniba riparia that has exhibited effects of antidepressant and anxiolytic activities in acute stress behavioral models.Fórmula:C16H17NO4Pureza:95.13%Forma y color:SolidPeso molecular:287.31BLU-945
CAS:BLU-945 is a reversible, potent, highly selective, and orally available epidermal growth factor receptor tyrosine kinase inhibitor (TKIs).Cost-effective and quality-assured.
Fórmula:C28H37FN6O3SPureza:99.11% - 99.16%Forma y color:SolidPeso molecular:556.7Pyridoxylamine
CAS:Pyridoxylamine (pyridoxamine) is an inhibitor of advanced glycation end production (AGEs) and lipoxidation end products (ALEs).Fórmula:C8H12N2O2Pureza:99.66%Forma y color:SolidPeso molecular:168.191-EBIO
CAS:1-EBIO (1-EBIO) is a calium channel agonist.Fórmula:C9H10N2OPureza:98.75%Forma y color:SolidPeso molecular:162.19Chloramphenicol
CAS:Chloramphenicol (Chloromycetin) is a broad-spectrum antibiotic that inhibits the biosynthesis of bacterial proteins. Cost-effective and quality-assured.
Fórmula:C11H12Cl2N2O5Pureza:99.6% - 99.84%Forma y color:Needles Or Elongated Plates From Water Or Ethylene Dichloride SolidPeso molecular:323.13XR-11576 HCl
XR-11576 HCl is a novel orally active dual topoisomerase I and II inhibitor with antitumor activity.Fórmula:C23H25ClN4O2Pureza:98.52%Forma y color:SoildPeso molecular:424.92EC5026
CAS:EC5026 (BPN-19186) has the potential to relieve pain by stabilizing natural analgesic and anti-inflammatory mediators.Fórmula:C18H23F4N3O3Pureza:96.6% - 99.81%Forma y color:SolidPeso molecular:405.39RUVBL1/2 ATPase-IN-1
CAS:RUVBL1/2 ATPase-IN-1 inhibits RUVBL1/2 ATPase (IC50: 6.0/7.7 μM); useful in cancer research.Fórmula:C28H28F3N5OPureza:99.92%Forma y color:SolidPeso molecular:507.55Clomipramine hydrochloride
CAS:Clomipramine HCl (Anafranil) is a serotonin-inhibiting tricyclic antidepressant, well-absorbed and metabolized to desmethylclomipramine in the liver.Fórmula:C19H23ClN2·HClPureza:99.04% - 99.47%Forma y color:White To Slightly Yellow Crystalline PowderPeso molecular:351.31Cloxiquine
CAS:Cloxiquine (Dermofongin) is a monohalogenated 8-hydroxyquinoline with activity against bacteria, fungi, and protozoa.Fórmula:C9H6ClNOPureza:99.82% - 99.87%Forma y color:Light Yellow CrystalsPeso molecular:179.6Ampicillin Trihydrate
CAS:Ampicillin Trihydrate (NCI-C56086), a broad-spectrum semisynthetic derivative of aminopenicillin, is a β-lactam antibiotic.Fórmula:C16H19N3O4S·3H2OPureza:98.40% - 99.73%Forma y color:White Solid PowderPeso molecular:403.45EN106
CAS:EN106: Powerful FEM1B inhibitor and covalent cysteine ligand, blocks FNIP1 binding.
Fórmula:C13H13ClN2O3Pureza:99.87%Forma y color:SolidPeso molecular:280.71Nortropinone hydrochloride
CAS:Nortropinone hydrochloride is used as a pharmaceutical intermediate.Fórmula:C7H12ClNOPureza:99.69% - 99.86%Forma y color:White To Off-White SolidPeso molecular:161.63Oxybutynin chloride
CAS:Oxybutynin chloride (Oxybutynin HCl) is an anticholinergic medication used to relieve urinary and bladder difficulties.Fórmula:C22H32ClNO3Pureza:99.27% - >99.99%Forma y color:White PowderPeso molecular:393.96p-Coumaric acid
CAS:p-Coumaric acid (para-Coumaric Acid) is the abundant isomer of cinnamic acid, with antitumor and anti-mutagenic activities.Fórmula:C9H8O3Pureza:99.51% - 99.64%Forma y color:White CrystalPeso molecular:164.16Turosteride
CAS:Turosteride is a small molecule steroidal 5α-reductase (5α-reductase) inhibitor.Turosteride has antitumor activity for the treatment of oncologic diseases andFórmula:C27H45N3O3Pureza:99.85%Forma y color:SolidPeso molecular:459.66Antipyrine
CAS:Antipyrine, an analgesic/antipyretic, used orally or as ear drops, tests liver enzyme response to diseases/drugs.Fórmula:C11H12N2OPureza:99.77%Forma y color:SolidPeso molecular:188.23Simtuzumab
CAS:Simtuzumab, a monoclonal antibody targeting LOXL2, treats PSC but fails in NASH-related fibrosis/cirrhosis.
Pureza:> 95%Forma y color:LiquidPeso molecular:150.00 kDaVitamin D2
CAS:Ergocaliferol (Vitamin D2), derived from ergosterol by UV, inhibits bladder tumor promotion and leukemia, and blocks DNA Polymerase.Fórmula:C28H44OPureza:98.73% - 99.89%Forma y color:Prisms From Acetone 1998)Peso molecular:396.659-hydroxy Stearic Acid
CAS:9-hydroxy Stearic Acid, a 9-PAHSA metabolite, inhibits HDAC1 in HT-29 cells and arrests cell cycle at 100 μM.
Fórmula:C18H36O3Pureza:99.7%Forma y color:SolidPeso molecular:300.48Acetoacetic acid sodium salt
CAS:Acetoacetic acid sodium salt is a metabolite of non-esterified fatty acids, involved in the development of human diabetes.Fórmula:C4H5NaO3Pureza:≥98%Forma y color:SolidPeso molecular:124.07Ref: TM-T13528
1mg46,00€2mg62,00€5mg90,00€10mg137,00€25mg216,00€50mg324,00€100mg482,00€500mg1.044,00€Amlodipine
CAS:Amlodipine (UK-48340) is a synthetic dihydropyridine and a calcium channel blocker with antihypertensive and antianginal properties.
Fórmula:C20H25ClN2O5Pureza:99.33% - 99.60%Forma y color:Solid PowderPeso molecular:408.88VU591 hydrochloride
CAS:VU591 hydrochloride is a selective Kir1.1 (ROMK) blocker with IC50 of 0.24 μM, not affecting Kir7.1, Kir2.1, Kir2.3, or Kir4.1, similar to VU 590.Fórmula:C16H13ClN6O5Pureza:98.93% - 99.22%Forma y color:SolidPeso molecular:404.76Ref: TM-T13320
1mg34,00€5mg71,00€10mg105,00€25mg215,00€50mg366,00€100mg512,00€200mg695,00€1mL*10mM (DMSO)79,00€Polyinosinic-polycytidylic acid sodium
CAS:Polyinosinic-polycytidylic acid sodium (Poly(I:C) sodium) is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) andFórmula:(C10H13N4O8P)x·(C9H14N3O8P)x·xNaPureza:98%Forma y color:SolidPeso molecular:695.403Aniracetam
CAS:Aniracetam (Ro 13-5057)(Ro 13-5057), a nootropic and neuroprotective drug, selectively modulates the AMPA receptor and nAChR.Fórmula:C12H13NO3Pureza:99.88% - 99.89%Forma y color:White Crystalline Or Crystalline PowdePeso molecular:219.24Oxaprozin
CAS:Oxaprozin (Oxaprozinum) is a Nonsteroidal Anti-inflammatory Drug.
Fórmula:C18H15NO3Pureza:98.53%Forma y color:SolidPeso molecular:293.32Itraconazole
CAS:Itraconazole (R51211) is a triazole antifungal agent that inhibits cytochrome P-450-dependent enzymes required for ERGOSTEROL synthesis.Fórmula:C35H38Cl2N8O4Pureza:98% - 99.90%Forma y color:Off-White Crystalline SolidPeso molecular:705.63Cyclandelate
CAS:Cyclandelate (BS 572), a direct-acting smooth muscle relaxant, is used to dilate blood vessels.Fórmula:C17H24O3Pureza:97.01% - 97.03%Forma y color:Crystals SolidPeso molecular:276.37Nefopam hydrochloride
CAS:Nefopam hydrochloride (Nefopam HCl) is the hydrochloride salt form of nefopam, a centrally-acting, non-opioid benzoxazocine with analgesic activity.Fórmula:C17H20ClNOPureza:99.32% - 99.85%Forma y color:SolidPeso molecular:289.8Nav1.8-IN-4
CAS:Nav1.8-IN-4 is a potent Nav1.8 channel inhibitor with potential analgesic activity.Nav1.8-IN-4 can be used for pain and neurological related disorders.Fórmula:C20H14F4N2O3Pureza:99.83%Forma y color:SoildPeso molecular:406.33Ref: TM-T77693
1mg59,00€2mg85,00€5mg125,00€10mg188,00€25mg376,00€50mg612,00€100mg938,00€500mg1.882,00€Oxelumab
CAS:Oxelumab (R 4930) is a human monoclonal antibody for OX40L. Oxelumab could be used to study asthma.
Pureza:> 95%Forma y color:LiquidPeso molecular:150 kDaCimetidine
CAS:Cimetidine (SKF-92334) is a histamine congener, it competitively inhibits HISTAMINE binding to HISTAMINE H2 RECEPTORS.Fórmula:C10H16N6SPureza:99.82%Forma y color:Crystals Physical Description White Crystals With A Slight Sulfur-Mercaptan Odor (Ntp 1992)Peso molecular:252.34Niraparib (R-enantiomer)
CAS:Niraparib R-enantiomer (MK 4827 R-enantiomer) is an inhibitor of PARP1(IC50 of 2.4 nM).
Fórmula:C19H20N4OPureza:99.83%Forma y color:SolidPeso molecular:320.39Sodium montmorillonite
CAS:Sodium montmorillonite (Bentolite) can catalyze reactions of the 5'-phosphorimidazolide of adenosine used as a model generated RNA type oligomers.Fórmula:Al1·67Mg0(Ca0Na0·33Si4(OH)2O10·xH2OPureza:98%Forma y color:Powder SolidPeso molecular:282.21Glycyrrhisoflavone
CAS:Glycyrrhisoflavone is a tyrosinase inhibitor with anti-inflammatory effects. Glycyrrhisoflavone inhibits α-glucosidase and monoamine oxidase.Fórmula:C20H18O6Pureza:99.76%Forma y color:SolidPeso molecular:354.35Betaxolol hydrochloride
CAS:Betaxolol HCl (SL 75212) is a cardioselective beta-blocker for hypertension without reported liver injury.Fórmula:C18H30ClNO3Pureza:99.48% - 99.56%Forma y color:SolidPeso molecular:343.89Paromomycin Sulfate
CAS:Paromomycin Sulfate, an aminoglycoside antibiotic, binds to 30S ribosomes, disrupting protein synthesis and killing bacteria.Fórmula:C23H47N5O18SPureza:99.73% - 99.86%Forma y color:SolidPeso molecular:713.71Naluzotan hydrochloride
CAS:Naluzotan hydrochloride, a hERG K+ blocker (IC50: 3800 nM) and potent 5-HT1A agonist (IC50: ~20 nM, Ki: ~5.1 nM), is used in anxiety and depression studies.
Fórmula:C23H39ClN4O3SPureza:99.96%Forma y color:SolidPeso molecular:487.1Monomethyl fumarate
CAS:Monomethyl fumarate is a potent agonist of GPR109A .Fórmula:C5H6O4Pureza:99.21%Forma y color:SolidPeso molecular:130.1L-Azidohomoalanine hydrochloride
CAS:L-Azidohomoalanine hydrochloride (H-L-Aha-OH hydrochloride) is an alkyl chain-based PROTAC linker.
Fórmula:C4H9ClN4O2Pureza:98.16% - 99.43%Forma y color:SolidPeso molecular:180.59Vilobelimab
CAS:Vilobelimab (CaCP-29, IFX-1), a monoclonal antibody, inhibits C5a to reduce inflammation and is researched in sepsis and COVID-19 studies.Pureza:99% (SDS-PAGE); 98.9% (SEC-HPLC) - 99% (SDS-PAGE); 98.9% (SEC-HPLC)Forma y color:LiquidFM4-64
CAS:FM4-64 (SynaptoRedTM C2) is a stylenoid dye. FM4-64 can be used to study endocytosis exocytosis and vesicle trafficking. High-Quality, Low-Cost!
Fórmula:C30H45Br2N3Pureza:99.41% - 99.411%Forma y color:SolidPeso molecular:607.51(Rac)-GSK 372475
CAS:(Rac)-GSK 372475 may be investigated for the treatment of Parkinson's syndrome, depression and obesity.Fórmula:C16H21Cl2NOPureza:96.76% - 99.91%Forma y color:SolidPeso molecular:314.25Sarizotan 2HCl
CAS:Sarizotan 2HCl is an hERG channel inhibitor and 5-hydroxytryptamine 5-HT1A receptor agonist with potential antidepressant effects for the study of Parkinsonian movement disorders.Fórmula:C22H23Cl2FN2OPureza:98.83%Forma y color:SoildPeso molecular:421.34Dutasteride
CAS:Dutasteride (GI 198745) is a 5-alpha-reductase inhibitor that inhibits both type-1 and type2 isoforms of the enzyme and is used to treat benign prostaticFórmula:C27H30F6N2O2Pureza:99.58%Forma y color:White Crystalline SolidPeso molecular:528.53Ref: TM-T1499
5mg35,00€10mg54,00€25mg84,00€50mg100,00€100mg150,00€200mg203,00€500mg341,00€1mL*10mM (DMSO)54,00€BMS-195270
CAS:BMS-195270 is a bio-active chemical.Fórmula:C15H9ClF3N3O2Pureza:98.7%Forma y color:SolidPeso molecular:355.7Ampreloxetine hydrochloride
CAS:Ampreloxetine hydrochloride (TD-9855 HCl) has anti-inflammatory activity and is a potential compound for the treatment of depression and Alzheimer's disease.Fórmula:C18H19ClF3NOPureza:99.59% - 99.96%Forma y color:SoildPeso molecular:357.811-β-hydroxyandrostenedione
CAS:11-Beta-hydroxyandrostenedione (NSC-17102), adrenal steroid, inhibits 11β-hydroxysteroid dehydrogenase; used to trace hyperandrogenism sources.Fórmula:C19H26O3Pureza:98.96%Forma y color:SolidPeso molecular:302.41Ref: TM-T14001
5mg47,00€10mg70,00€25mg126,00€50mg197,00€100mg298,00€500mg715,00€1mL*10mM (DMSO)50,00€B-Raf IN 2
CAS:B-Raf IN 2, compound Ia, is a highly effective and specific inhibitor of BRAF. It exhibits significant potential for cancer research.Fórmula:C20H17F2N5O4SPureza:98.86%Forma y color:SolidPeso molecular:461.44Glucose oxidase
CAS:Glucose oxidase is an enzyme extracted from the fungus Aspergillus niger, which is an important industrial enzyme in the food industry.Forma y color:SolidD-Carnitine hydrochloride
CAS:D-Carnitine hydrochloride ((S)-Carnitine Hydrochloride), a constituent of striated muscle and liver, is used in the treatment of hyperlipoproteinemias.Fórmula:C7H15NO3·HClPureza:99.77%Forma y color:SolidPeso molecular:197.66Ref: TM-T2203
5mg43,00€10mg52,00€25mg71,00€50mg102,00€100mg133,00€200mg180,00€500mg303,00€1mL*10mM (DMSO)42,00€6PPD-Q
CAS:6PPD-Q (6PPD-Quinone) is an environmental pollutant that can target CNR2, CNR1, AA2AR, LCAT and TRPA1. High-Quality, Low-Cost!Fórmula:C18H22N2O2Pureza:98.43% - 99.40%Forma y color:SolidPeso molecular:298.382,3,4-Trimethoxybenzaldehyde
CAS:2,3,4-Trimethoxybenzaldehyde (Trimethoxybenzaldehyde) is used as medicine intermediate.Fórmula:C10H12O4Pureza:99.86%Forma y color:White To Off-White Crystalline PowderPeso molecular:196.2Urocortin (rat) acetate
Urocortin (rat) acetate: CRF receptor agonist; Ki=13nM (hCRF1), 1.5nM (rCRF2α), 0.97nM (mCRF2β); neuropeptide.Pureza:97.76%Forma y color:SoildNE 52-QQ57
CAS:NE 52-QQ57 is a selective, and orally available antagonist of GPR4(IC50 : 70 nM),with anti-inflammatory activity.Fórmula:C24H28N6OPureza:98.63%Forma y color:SolidPeso molecular:416.52SD49-7
CAS:SD49-7 is an inhibitor of histone lysine demethylase 4 (KDM4) with an IC50 of 0.19 µM.
Fórmula:C18H14N2O3Pureza:99.91%Forma y color:SoildPeso molecular:306.32Arvenin II
CAS:Arvenin II is a natural product from Hemsleya amabilis.Fórmula:C38H58O13Pureza:98%Forma y color:SolidPeso molecular:722.869GSK3a-IN-38
CAS:GSK3a-IN-38 is a novel small molecule compound that has inhibitory effects on GSK-3a.Fórmula:C18H20N4OPureza:99.75%Forma y color:SoildPeso molecular:308.38Macrocarpal J
CAS:Macrocarpal J has anti-bacterial activity, it also has anti-glucosyltransferase activity.Fórmula:C28H42O7Pureza:98%Forma y color:SolidPeso molecular:490.637TPT-260
CAS:TPT-260 is a thiophene thiourea derivative.Fórmula:C8H12N4S3Pureza:98%Forma y color:SolidPeso molecular:260.40ACH-702
CAS:ACH-702 is an agent of anti-tubercular. ACH-702 is an effective, bactericidal compound with activity against many antibiotic-resistant pathogens.Fórmula:C21H25FN4O3SPureza:98%Forma y color:SolidPeso molecular:432.51Diosbulbin C
CAS:Diosbulbin C has hepatotoxicity.Fórmula:C19H22O7Pureza:98%Forma y color:SolidPeso molecular:362.378Bactenecin
CAS:Bactenecin is a cyclic antimicrobial peptide isolated from bovine neutrophils with potent activity against Bacterial and Fungal species.
Fórmula:C63H118N24O13S2Pureza:98%Forma y color:SolidPeso molecular:1483.91Somantadine
CAS:Somantadine has antiviral activities and can be used for research on preventing and treating coronavirus-related diseases.Fórmula:C14H25NPureza:99.9%Forma y color:SolidPeso molecular:207.35CB2 PET Radioligand 1
CB2 PET Radioligand 1 (compound [18F]9) is a positron emission tomography (PET) radioligand with high affinity for the human cannabinoid receptor 2 (hCB2, Ki=7.Fórmula:C20H19F3N4OPureza:98%Forma y color:SolidPeso molecular:388.39TT 232
CAS:sst1/sst4 somatostatin receptors agonistFórmula:C45H58N10O9S2Pureza:98%Forma y color:SolidPeso molecular:947.13FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Forma y color:SolidPeso molecular:3692.15Diamyl phthalate
CAS:Diamyl phthalate is an agent of endocrine disruptor.Fórmula:C18H26O4Pureza:98%Forma y color:SolidPeso molecular:306.40α-Hydroxyglutaric Acid Lithium
α-Hydroxyglutaric Acid Lithium is an α-ketoglutarate-dependent dioxygenase and 5-methylcytosine hydroxylase inhibitor of ATP synthase.Fórmula:C5H6Li2O5Pureza:≥98%Forma y color:SoildPeso molecular:159.98Tilifodiolide
CAS:Tilifodiolide exerts in vitro and in vivo anti-inflammatory activity and in vivo antinociceptive effects.Fórmula:C20H16O5Pureza:98%Forma y color:SolidPeso molecular:336.34Sulfo-SPP
CAS:Sulfo-SPP is a heterobifunctional, thiol-cleavable and membrane impermeable crosslinker.Fórmula:C14H16N2O7S3Pureza:98%Forma y color:SolidPeso molecular:420.48Amylin (8-37), rat
CAS:Amylin (8-37), rat, an analog of IAPP, blocks insulin's effects on muscle glucose uptake and glycogen storage.Fórmula:C140H227N43O43Pureza:98%Forma y color:SolidPeso molecular:3200.61SGC3027
SGC3027 is an inhibitor of histone methyltransferase,also is a first potent, selective and cell active chemical probe for PRMT7.Fórmula:C41H47ClN6O6SPureza:98%Forma y color:SolidPeso molecular:787.371-O-galloyl-6-O-cinnamoylglucose
CAS:1-O-galloyl-6-O-cinnamoylglucose is a natural product for research related to life sciences. The catalog number is TN6483 and the CAS number is 115746-69-5.Fórmula:C22H22O11Pureza:98%Forma y color:SolidPeso molecular:462.4Wedeliatrilolactone A
CAS:Wedeliatrilolactone A is a natural product from Wedelia trilobata.Fórmula:C23H32O9Pureza:98%Forma y color:SolidPeso molecular:452.49Calmodulin-Dependent Protein Kinase II 290-309 acetate
Calmodulin-Dependent Protein Kinase II 290-309 acetate is an effective antagonist of Ca2+/calmodulin-dependent protein kinase II (IC50 = 52 nM).Fórmula:C105H189N31O26SPureza:96.7%Forma y color:SolidPeso molecular:2333.88(2E)-3-(1,3-Benzodioxol-5-yl)-2-propenoic acid
CAS:(2E)-3-(1,3-Benzodioxol-5-yl)-2-propenoic acid displays EC50 values of 73.5 μM against T. cruzi. trypomastigotes.Fórmula:C10H8O4Pureza:99.87%Forma y color:SolidPeso molecular:192.17(-)-Denudatin B
CAS:Denudatin B, from Magnolia fargesii, inhibits platelets via phosphoinositide breakdown blockage.Fórmula:C21H24O5Pureza:99.69%Forma y color:SolidPeso molecular:356.41I-BOP
CAS:I-BOP is an agonist (KD=0.61 nM) at the thromboxane A2 receptor (TP).Fórmula:C23H29IO5Forma y color:SolidPeso molecular:512.384VEGFR-2/c-Met-IN-1
VEGFR-2/c-Met-IN-1 is a dual inhibitor targeting VEGFR-2 and c-Met with respective IC50 values of 138 nM and 74 nM, demonstrating antitumor activity [1].Pureza:98%Forma y color:Odour SolidSulfo-NHS-LC-Biotin sodium
CAS:Sulfo-NHS-LC-Biotin sodium is an amine-reactive biotinylation reagent for antibody labeling.
Fórmula:C20H29N4NaO9S2Pureza:98.54% - 99.83%Forma y color:SolidPeso molecular:556.59Lys-[Hyp3]-Bradykinin
CAS:Lys-[Hyp3]-Bradykinin, a human urine-derived kinin and bradykinin agonist, is used for inflammation research.Fórmula:C56H85N17O13Forma y color:SolidPeso molecular:1204.38ZINC05007751
CAS:ZINC05007751 inhibits NEK6 (IC50=3.4μM), selective for NEK1/6, inactive on NEK2/7/9.Fórmula:C18H12N2O3Pureza:99.7%Forma y color:SolidPeso molecular:304.3Gyrophoric acid
CAS:Vulpinic and gyrophoric acids are known as ultraviolet filters for natural lichen populations, they can effectively prevent cytotoxic, apoptotic andFórmula:C24H20O10Pureza:98%Forma y color:SolidPeso molecular:468.41Kansuinine B
CAS:Kansuinine B inhibits Stat3 activation induced by IL-6. Kansuinine B exhibits anti-viral activity and could be used in COVID-19 research.Fórmula:C38H42O14Pureza:98.17%Forma y color:SolidPeso molecular:722.73Saikosaponin E
CAS:Saikosaponin E is a natural product isolated from the herbs of Bupleurum.Fórmula:C42H68O12Pureza:96.25% - 99.76%Forma y color:SolidPeso molecular:764.98Phosphostim Sodium
CAS:Phosphostim, a gamma9deta2 T lymphocytes agonist, is used potentially for the treatment of renal cell carcinoma, HCV infection.Fórmula:C5H10BrNa3O8P2Pureza:98%Forma y color:SolidPeso molecular:408.95Mal-PEG2-NH-Boc
CAS:Mal-PEG2-NH-Boc is a PEG-based linker for PROTACs which joins two essential ligands, crucial for forming PROTAC molecules.Fórmula:C15H24N2O6Pureza:98%Forma y color:SolidPeso molecular:328.36Eledoisin
CAS:Eledoisin (Eledone peptide) is a specific agonist of NK2 and NK3 receptors.Eledoisin is an undecapeptide of mollusk origin, belonging to the tachykinin familyFórmula:C54H85N13O15SPureza:98%Forma y color:SolidPeso molecular:1188.4Nb-Feruloyltryptamine
CAS:Nb-Feruloyltryptamine is a natural product for research related to life sciences. The catalog number is TN6571 and the CAS number is 53905-13-8.Fórmula:C20H20N2O3Pureza:98%Forma y color:SolidPeso molecular:336.391p-SCN-Bn-TCMC HCl
CAS:p-SCN-Bn-TCMC: A bifunctional chelator with TCMC for binding heavy metal ions, and reactive thioisocyanate for conjugating biomolecules.Fórmula:C24H41Cl4N9O4SPureza:98%Forma y color:SolidPeso molecular:693.51PAK4-IN-3
PAK4-IN-3 (compound 27e) is a PAK4 inhibitor exhibiting an IC50 of 10 nM and demonstrates antiproliferative effects on A549 cells with an IC50 of 0.61μM.Pureza:98%Forma y color:Odour SolidD-Fructose-13C6
CAS:D-Fructose-13C6 can be used as an internal standard for the quantification of D-fructose by GC- or LC-MS.Fórmula:C6H12O6Pureza:98% - 99.64%Forma y color:SolidPeso molecular:186.11Isomorellic acid
CAS:Isomorellic acid is a cytotoxic caged xanthone.Fórmula:C33H36O8Pureza:98%Forma y color:SolidPeso molecular:560.63Mini Gastrin I, human TFA (54405-27-5 free base)
Mini Gastrin I, human (TFA) is short for human Gastrin. It is a mother peptide composed of 5-17 amino acids.Fórmula:C76H100F3N15O28SPureza:98%Forma y color:SolidPeso molecular:1760.75L-Hamamelose
CAS:L-Hamamelose plays a significant role as a chiral building block in synthesizing a wide variety of enantiopure compounds.Fórmula:C6H12O6Pureza:98%Forma y color:SolidPeso molecular:180.16Meliasendanin D
CAS:Meliasendanin D is a natural product from Melia toosendan.Fórmula:C20H24O8Pureza:98%Forma y color:SolidPeso molecular:392.4Kinetensin
CAS:Kinetensin is a neurotensin-like peptide.Fórmula:C56H85N17O11Pureza:98%Forma y color:White Lyophilised SolidPeso molecular:1172.38BCN-PEG4-OH
BCN-PEG4-OH is a non-cleavable 4-unit PEG linker essential for synthesizing antibody-drug conjugates (ADCs)[1].Fórmula:C19H31NO6Pureza:98%Forma y color:SolidPeso molecular:369.45
![Lys-[Hyp3]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FT76293.webp&w=3840&q=75)
