
GPCR/Proteína-G
Os inibidores de GPCR/proteínas G são compostos que têm como alvo os receptores acoplados a proteínas G (GPCRs) e as proteínas G associadas, que desempenham papéis críticos na transmissão de sinais do exterior para o interior das células. Esses inibidores são essenciais para estudar as vias de sinalização mediadas por GPCRs, que estão envolvidas em numerosos processos fisiológicos, incluindo percepção sensorial, resposta imunológica e neurotransmissão. Os inibidores de GPCR também são importantes no desenvolvimento de medicamentos, pois muitos agentes terapêuticos têm como alvo esses receptores. Na CymitQuimica, oferecemos uma ampla gama de inibidores de GPCR/proteínas G de alta qualidade para apoiar sua pesquisa em farmacologia, biologia celular e áreas afins.
Subcategorias de "GPCR/Proteína-G"
- Receptor 5-HT(939 produtos)
- Receptor de adenosina(242 produtos)
- Receptor adrenérgico(2.945 produtos)
- Receptor de Bombesina(30 produtos)
- Receptor de Bradicinina(59 produtos)
- CXCR(148 produtos)
- CaSR(32 produtos)
- Receptor de Canabinóides(195 produtos)
- Receptor de Dopamina(407 produtos)
- Receptor Endotelina(76 produtos)
- Receptor GNRH(73 produtos)
- GPCR19(31 produtos)
- GRK(31 produtos)
- GTPase(21 produtos)
- Receptor Glucagon(165 produtos)
- Hedgehog/Smoothened(44 produtos)
- Receptor de Histamina(358 produtos)
- Receptor LPA(21 produtos)
- Receptor de Melatonina(24 produtos)
- Receptor OX(40 produtos)
- Receptor opioide(297 produtos)
- PAFR(11 produtos)
- PKA(48 produtos)
- Receptor S1P(17 produtos)
- SGLT(30 produtos)
- Receptor Sigma(46 produtos)
Exibir 18 mais subcategorias
Foram encontrados 5352 produtos de "GPCR/Proteína-G"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Luseogliflozin hydrate
CAS:<p>Luseogliflozin hydrate: SGLT2 inhibitor, IC50 2.26 nM, oral, for type 2 diabetes research.</p>Fórmula:C23H32O7SCor e Forma:SolidPeso molecular:452.5611β-Prostaglandin E2
CAS:<p>11β-PGE2 is the C-11 epimer of PGE2.</p>Fórmula:C20H32O5Cor e Forma:SolidPeso molecular:352.47(+)-Oxypeucedanin methanolate
CAS:<p>(+)-Oxypeucedanin methanolate (compound 9) is a natural compound that inhibits prostaglandin E2 production [1].</p>Fórmula:C17H18O6Cor e Forma:SolidPeso molecular:318.32PG106 TFA
<p>PG106 TFA is a potent hMC3 antagonist (IC50=210 nM), inactive at hMC4 (EC50=9900 nM) and hMC5 receptors.</p>Fórmula:C53H70F3N13O11Cor e Forma:SolidPeso molecular:1122.2GHRF, porcine
CAS:<p>GHRF, porcine, a growth hormone releasing factor (GHRF) peptide (porcine), binds to the growth hormone secretagogue receptor (GHSR), thereby inducing the</p>Fórmula:C219H365N73O66SCor e Forma:SolidPeso molecular:5108.76α-Helical CRF(9-41) TFA
<p>α-Helical CRF(9-41) TFA acts as a competitive antagonist for the CRF2 receptor, possessing a binding constant (K B) of approximately 100 nM.</p>Fórmula:C168H275F3N46O55S2Cor e Forma:SolidPeso molecular:3940.42Corazonin
CAS:<p>Corazonin, a neuropeptide in insects, regulates caste identity and behavior, mainly in workers/foragers.</p>Fórmula:C62H83N17O19Cor e Forma:SolidPeso molecular:1370.42dCNP
<p>dCNP binds to NPR-B/C receptors (NPR-B/C receptor), initiating the cGMP signaling pathway and regulating vascular function. It exhibits anti-hypoxic effects by downregulating hypoxia-related genes such as HIF1α and HIF2α. Additionally, dCNP inhibits tumor stroma induction, demonstrating antifibrotic properties. It also enhances immune response by upregulating CTL, NK cells, and conventional type 1 dendritic cells in tumors.</p>Fórmula:C141H248N38O36S3Cor e Forma:SolidPeso molecular:3147.91Neurokinin Receptor (393-407), rat
CAS:<p>Rat NK1R fragment (393-407) binds SP, enabling endocytosis and plasma membrane recycling; key in neurogenic inflammation research.</p>Fórmula:C72H113N17O26S2Cor e Forma:SolidPeso molecular:1696.9[His1,Nle27] GHRF (1-32), amide, human
CAS:<p>[His1,Nle27] GHRF (1-32), amide, human is a potent GHRH analog with high GHRHR affinity.</p>Fórmula:C159H265N51O46Cor e Forma:SolidPeso molecular:3627.12ANP [Des18-22] 4-23 amide rat
CAS:<p>ANP [Des18-22] 4-23 amide rat is a peptide fragment of rat atrial natriuretic peptide (ANP) that specifically binds to NPR-C.</p>Fórmula:C64H107N25O19S2Cor e Forma:SolidPeso molecular:1594.82AZ7976
CAS:<p>AZ7976 (Compound 42), a potent and highly selective agonist for Relaxin Family Peptide Receptor 1 (RXFP1) with a pEC 50 value greater than 10.5, operates through an allosteric mechanism to enhance RXFP1's cAMP signaling, which physiologically elevates heart rate. This property makes AZ7976 a valuable tool in cardiovascular disease research [1].</p>Fórmula:C30H33F7N2O6SCor e Forma:SolidPeso molecular:682.65γ-1-Melanocyte Stimulating Hormone (MSH), amide
<p>γ-1-Melanocyte Stimulating Hormone (MSH), amide, a peptide consisting of 11 amino acids, plays a critical role in regulating sodium (Na+) balance and blood</p>Fórmula:C72H97N21O14SCor e Forma:SolidPeso molecular:1512.9FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
<p>FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.</p>Cor e Forma:SolidPeso molecular:3692.15PACAP (1-38) free acid TFA
<p>PACAP (1-38) free acid TFA, an endogenous neuropeptide, effectively enhances antral motility and somatostatin secretion, while concurrently suppressing gastrin</p>Cor e Forma:Odour SolidPAMP-12 (unmodified) (TFA)
<p>PAMP-12 (unmodified) TFA, an endogenous peptide and potent MRGPRX2 (MrgX2) agonist (EC50=20-50 nM), induces hypotension by inhibiting catecholamine secretion</p>Fórmula:C79H119F3N24O17Cor e Forma:SolidPeso molecular:1733.94PG-931 TFA
<p>PG-931 TFA, a potent MC4 receptor agonist (IC50 0.58 nM), excels in selectivity and helps reverse hemorrhagic shock in vivo.</p>Fórmula:C61H86F3N15O13Cor e Forma:SolidPeso molecular:1294.42(2R,2R)-PF-07258669
CAS:<p>(2R,2R)-PF-07258669' is an antagonist for the MC4R (melanocortin 4 receptor), primarily studied for its role in regulating appetite and energy expenditure.</p>Fórmula:C25H27FN6O2Cor e Forma:SolidPeso molecular:462.52Melanostatin, frog
CAS:<p>Melanostatin, frog, is an inhibitor of α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM [1] [2].</p>Fórmula:C189H285N53O57SCor e Forma:SolidPeso molecular:4243.67α-CGRP(human) TFA
<p>α-CGRP(human) TFA is a 37-amino acid regulatory neuropeptide that is extensively located within the central and peripheral nervous system, functioning as a</p>Fórmula:C165H268F3N51O51S2Cor e Forma:SolidPeso molecular:3903.33

