Organic Halides

<p>Intermediate in the synthesis of tedizolid</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Trifluoroacetate salt</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromoethylamine HBr is a nonsteroidal anti-inflammatory drug that is used to treat inflammation and pain. It is a prodrug that is hydrolyzed in vivo to its active form, 2-bromoethylamine. The bound form of this drug has been shown to inhibit the development of cell nuclei in the nucleus of cells. This drug also inhibits the production of nitric oxide, which leads to cell death by necrosis. 2-Bromoethylamine HBr has been shown to have an inhibitory effect on the activity of glycol ethers, which are used as solvents for resins in coatings and adhesives. It also has the ability to form body tissue (e.g., papillary) and can be used as an experimental model for studying necrosis.</p>

<p>4-Fluoro-2-methoxyaniline is an inhibitor of tyrosine kinase. It is a molecule that has been isolated from the ground leaves of erythroxylon coca and is used in the treatment of diabetes mellitus. 4-Fluoro-2-methoxyaniline inhibits the growth factor receptor, epidermal growth factor (EGF), and its receptor, EGF receptor. This inhibition leads to decreased proliferation of epidermal cells and decreased insulin production by pancreatic beta cells. 4-Fluoro-2-methoxyaniline also has antioxidant properties, which may be due to its ability to scavenge free radicals.</p>

<p>Galnon trifluoroacetate salt is a pharmacological agent that binds to galanin and inhibits its binding to G protein-coupled receptors. It was shown to have a cancer preventive effect on 3T3-L1 preadipocytes by inhibiting the production of the inflammatory cytokine, tumor necrosis factor-α (TNF-α). Galnon trifluoroacetate salt also has an effect on the immune system and may be used as an anti-inflammatory agent in autoimmune diseases. This drug has been shown to block the effects of galanin on camp levels, leading to a decrease in locomotor activity.</p>

<p>Please enquire for more information about Cys(NPys)-Antennapedia Homeobox (43-58) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-Glu-Arg-Nle-Phe-Leu-Ser-Phe-Pro-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Furin inhibitor II is a small molecule that inhibits the activity of furin, which is an enzyme used in the processing of growth factor-β1. Furin inhibitor II binds to human receptors and blocks their binding to the surface glycoprotein on cancer cells. Furin inhibitor II also has physiological activities, such as reducing inflammation, inhibiting viral replication, and inhibiting the growth of bacteria. Furin inhibitor II may be useful for treating cancer or infectious diseases.</p>

<p>Please enquire for more information about Biotinyl-Obestatin (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Aminoindole hydrochloride is a heterocyclic amine that is formed by the reaction of benzene and an aminoindole. It is a difunctional compound that can react with alcohols to form amides, carbonyl groups to form ketones, or carbamate groups to form ureas. This compound has been shown to act as an activated aromatic amine that reacts with oxygen in the atmosphere to form a variety of products, including chlorinated aromatic amines. 2-Aminoindole hydrochloride has been shown to have carcinogenic effects in rats when administered orally at high doses.</p>

<p>3-Iodo-2-methylbenzoic acid is a reagent that is used as an intermediate in the synthesis of complex compounds and fine chemicals. 3-Iodobenzoic acid is classified as a speciality chemical, which means it can be used for research purposes only. 3-Iodo-2-methylbenzoic acid has many uses, including being a versatile building block in chemical reactions and a reaction component in the synthesis of useful scaffolds and building blocks.</p>

<p>Please enquire for more information about TRAF6 Peptide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dansyl-Ala-Arg-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Urocortin II (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Bromo-2-methylaniline is a six membered, planar, planar conformation with a dihedral angle of 120°. The molecule has two dimers that are connected by hydrogen bonds. It has a crystal structure that is made up of molecules arranged in a hexagonal grid. The molecule is made up of three atoms: one carbon atom, one nitrogen atom, and one bromine atom. The three atoms are arranged in the following order: bromine, carbon, nitrogen.</p>

<p>1-Hydroxy-6-(trifluoromethyl)benzotriazole is a chemical compound that is used as a reagent and an additive in organic synthesis. It has been shown to react with the 7-aminocephalosporanic acid to form a reactive molecule, which is then acylated with various amines. The reaction time can be modified by adding certain additives, such as chloride or uridine. 1-Hydroxy-6-(trifluoromethyl)benzotriazole is also a solid phase synthesis, which means it reacts with other molecules during the synthesis process to form new substances. It also has acidic properties, and can act as a nucleophile in the presence of aminocephalosporanic acid. The structural formula for this chemical is shown below:</p>

<p>Please enquire for more information about H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-A la-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-a-Me-Leu-Nle-Glu-Ile-Ile-NH 2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trifluoroacetate salt</p>

<p>Lactoferricin B (4-14) (bovine) trifluoroacetate salt is a peptide derivative, which is a fragment derived from bovine lactoferrin. It is obtained by enzymatic digestion of lactoferrin, a glycoprotein with a well-established role in the innate immune system. This specific peptide, Lactoferricin B (4-14), is known for its potent antimicrobial properties, attributed to its amphipathic structure that facilitates the disruption of microbial membranes. Additionally, it can modulate immune responses through interactions with immune cells, thereby influencing inflammatory processes.</p>

<p>TRAP-6 (2-6) is a monoclonal antibody that binds to the enzyme collagenase, which is an important factor in tumor invasion and metastasis. The antibody binds to the active site of collagenase, thereby inhibiting its activity. TRAP-6 (2-6) has been shown to reduce the growth of cancer cells by inhibiting the production of β-amino acids and zymogens, which are required for tumor cell proliferation. It also inhibits serine proteases, such as thrombin receptor, which play an important role in tumor invasion and metastasis. TRAP-6 (2-6) also has anti-inflammatory properties and can be used for the treatment of basophilic leukemia.</p>

<p>4-Chloro-Niacin is a lead compound for the treatment of diabetes. The drug is an agonist of the G protein coupled receptor, which is involved in glucose homeostasis and insulin secretion. 4-Chloro-Niacin has been shown to decrease blood glucose levels in diabetic rats by activating the G protein coupled receptor, thereby increasing the release of insulin from pancreatic beta cells. This compound also has an affinity for pyridine nucleotide receptors, suggesting that it may be useful for treating metabolic syndromes.</p>

<p>Please enquire for more information about TIP-39 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about HTLV-1 Tax (11-19) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Angiotensin II is a peptide hormone that is also known as angiotensin II trifluoroacetate salt. It has been shown to have cardioprotective effects in vivo and in vitro models. Angiotensin II has been shown to induce follicular growth, inhibit atherosclerotic lesion formation, and improve cardiac function. Angiotensin II can be used to treat patients with congestive heart failure or cardiovascular disease due to its ability to increase blood pressure and the rate of cardiac contractions. The drug also reduces systolic pressure by acting on receptors in the kidneys and vasculature, which are involved in the renin-angiotensin system.</p>

<p>Please enquire for more information about Acetyl-ACTH (2-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Des-Bromo)-Neuropeptide B (1-23) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Used in the synthesis of 6,6'-substituted BINOL chiral ligands</p>

<p>Please enquire for more information about Amyloid Dan Protein (1-34) (reduced) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Amide; Trifluoroacetate salt</p>

<p>5-Chloro-8-hydroxyquinoline (5-CQ) is a quinoline derivative that has been used as an anticancer agent. It binds to DNA and inhibits the synthesis of RNA and proteins, leading to cell death. 5-CQ has been shown to be cytotoxic against skin cells in vitro by inhibiting mitochondrial oxidative phosphorylation and decreasing the mitochondrial membrane potential. This compound also has genotoxic effects on cultured choroidal neovascularization cells through the inhibition of DNA synthesis.<br>5-CQ binds to DNA via hydrogen bonds with nitrogen atoms in the purine ring of nucleobases. The overall geometry is that of a distorted octahedron with two faces, each containing six nitrogens in square planar coordination geometry. The binding constants are low for purines but high for pyrimidines, which is why 5-CQ preferentially targets purine rich regions of the genome.</p>

<p>Please enquire for more information about Orphan GPCR SP9155 Agonist P550 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Vasopressin is a hormone that belongs to the family of peptide hormones. Vasopressin has been shown to be localized in many tissues, including the brain, where it acts as a neurotransmitter and neuromodulator. Vasopressin is released by the paraventricular nucleus of the hypothalamus and stored in the posterior pituitary gland, from which it is released into the circulation when needed. Vasopressin binds to V1 receptors and causes an increase in cytosolic calcium levels through activation of voltage-gated calcium channels. It also stimulates cell growth and proliferation through activation of tyrosine kinase receptors on cells.</p>

<p>Please enquire for more information about Nesfatin-1 (30-59) (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene is a chemical compound that is used as a sensor for electron transfer in organic molecules. When the molecule is oxidized, the bromine atom is reduced to hydrogen bromide, which is able to conduct electricity. This allows it to be used as a sensing electrode to measure electron transfer in organic molecules. 2-Bromo-7-iodo-9,9-dimethyl-9H-fluorene has been synthesized using experimental techniques and geometry experiments. The transport of electrons can be measured using electrodes with tripodal geometry with nanoscale dimensions.</p>

<p>Please enquire for more information about (Dab 9)-Neurotensin (8-13) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tribromomethyl phenyl sulfone is an alkylthio compound that has a cyclohexane ring and a hydroxy group. Tribromomethyl phenyl sulfone has high resistance to thermal expansion, hydrolysis, and radiation. It reacts with silver ions to form bromophenyl silver ion. This molecule can be formed through the reaction of diphenyl ether with hydrogen sulfide in the presence of light, or by the reaction of benzene with sodium hydroxide in the presence of light. Tribromomethyl phenyl sulfone is used as a stabilizer for plastics and other organic materials, as well as an antioxidant for rubber products.</p>

<p>Please enquire for more information about (Des-Gly10,D-His2,D-Ser4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro VIP (81-122) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Di-tert-butylchlorophosphine is a nucleophilic reagent used for the cross-coupling of aryl chlorides. It reacts with an amine to produce an imine, which can be hydrolyzed to form an amide. Di-tert-butylchlorophosphine is typically used in palladium-catalyzed coupling reactions and can react with ethene, propene, and butadiene to produce ethylbenzene, propenal, and butadienal. This compound also has been used as a precursor in the preparation of antiviral drug Covid®19. The reaction temperature for this compound is typically between -40°C and 0°C.</p>

<p>Please enquire for more information about (D-Arg6,Asn10)-MCH (6-16) amide (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(Beta-Asp5)-delta-Sleep Inducing Peptide is a synthetic molecule that has been shown to be an atypical compound. It is a fragment of the natural sleep-inducing peptide, which is also called clostridium sporogenes. The fragment was synthesized and found to have similar properties and structures as the natural form. The fragment is labile in neutral or acidic solution, but stable in basic conditions. (Beta-Asp5)-delta-Sleep Inducing Peptide can be used for the detection of methyltransferase activity, by using it as a substrate for methylation reactions and measuring the rate of spontaneous desorption from a matrix. This compound can also be used for proteomic studies by using matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI TOF MS) techniques.</p>

<p>Please enquire for more information about H-Tyr-Cys-Phe-Ala-Trp-Lys-Thr-Phe-Cys-OH trifluoroacetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Omega-agatoxin IVa trifluoroacetate is a neurotoxin that inhibits voltage-dependent calcium channels. It blocks the opening of these channels, leading to an increase in cytosolic calcium. This toxin has been shown to be effective in treating autoimmune diseases and also has shown antimicrobial effects against bacteria. Omega-agatoxin IVa trifluoroacetate has a pathogenic mechanism that involves the inhibition of neuronal death by glutamate through its ability to block the release of glutamate from the presynaptic neuron. This toxin also binds to cerebellar Purkinje neurons and prevents them from firing, which leads to paralysis. Omega-agatoxin IVa trifluoroacetate is a glycosylated peptide with a disulfide bond that can be isolated using preparative high performance liquid chromatography (HPLC).</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Preptin (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>O-Ethoxybenzoyl chloride is a pesticide that belongs to the group of sildenafil. It inhibits the activity of prolyl endopeptidase, an enzyme that degrades the peptide hormone vasoactive intestinal polypeptide (VIP). This inhibition prevents degradation of VIP, which is important for the regulation of blood vessel tone. The compound has been shown to be effective against Sclerotinia sclerotiorum and Claviceps purpurea. O-Ethoxybenzoyl chloride has been shown to have a high level of tolerance in plants and animals. It also has been found to be safe for humans with its low toxicity levels and low acute toxicity. It is not classified as hazardous by the World Health Organization (WHO).</p>

<p>Please enquire for more information about ACTH (1-14) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Trimeperidine hydrochloride is a postoperative analgesic that is used in the treatment of nerve pain and other conditions. Trimeperidine hydrochloride belongs to the group of active substances. It has been shown to be effective as an epidural anesthesia for patients undergoing surgery and has a clinical effect on the nervous system, including pain, nausea, vomiting, and muscle spasms. Trimeperidine hydrochloride works by inhibiting the central nervous system (CNS) enzyme coagulation factor XIIa. It also prevents excessive release of neurotransmitters from nerve cells.br&gt;br&gt;</p>

<p>Poly(tetrafluoroethylene-co-perfluoro(propylvinyl ether)) is a multilayer, unsaturated, vinylidene polymer. It has an impermeability that is similar to polytetrafluoroethylene (PTFE), but with improved mechanical properties. Poly(tetrafluoroethylene-co-perfluoro(propylvinyl ether)) can be used as a coating on surfaces that are exposed to chemical substances or in food packaging. This material is also used in the production of laminated products and copolymers.</p>

<p>Please enquire for more information about (D-His2)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Lys-Thymic Factor trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-4 (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta-Protein (33-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Asp(OMe)-Gln-Met-DL-Asp(OMe)-fluoromethylketone is a mitochondria-targeting compound that has been shown to have neuroprotective and anti-inflammatory properties. It binds to the ATP synthase in the mitochondrial membrane, inhibiting ATP production and causing cell death by apoptosis. ZAFMK also inhibits kinases such as protein kinase 3β (PK3β) and caspase 9, which are involved in inflammation and apoptosis. ZAFMK has been shown to be effective against various diseases such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, Huntington's disease, and stroke.</p>

<p>Please enquire for more information about Dermcidin-1L (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Osteostatin is a recombinant human protein that inhibits bone growth by binding to and neutralizing the effect of forskolin. Osteostatin also has an inhibitory effect on cancer cells, as it inhibits mitochondrial pathways and prevents the activation of factor receptors. Osteostatin blocks the synthesis of cAMP, which is necessary for cell proliferation in cancer cells. The inhibition of cAMP levels leads to a decrease in the production of proteins that stimulate bone growth, such as runx2.</p>

<p>Please enquire for more information about Hepcidin-1 (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Xenopsin-related peptide 1 (XP-1) is a synthetic peptide that has been shown to bind to the neurotensin receptor. XP-1 is expressed in gastrointestinal tissues and has been found to modulate intestinal motility, as well as glucose homeostasis. It also has immunohistochemical staining for pancreatic tissues and vasoactive intestinal polypeptide, which are both involved in glucose control. XP-1 can reduce high plasma concentrations of glucose by stimulating the pancreas and lowering the release of glucagon from the α cells of the pancreas. The function of XP-1 is not yet fully understood, but it may have potential therapeutic effects on diabetes mellitus type 2.</p>

<p>Please enquire for more information about (D-Ser4,D-Trp6)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin B is a peptide hormone that is produced by the hypothalamus and regulates many physiological processes such as energy metabolism, appetite, and sleep. Neuromedin B is a member of the family of guanine nucleotide-binding proteins (G proteins) that bind to G protein-coupled receptors on the surface of cells. It has been shown to stimulate calcium release from intracellular stores in response to an increase in cytosolic Ca2+. Neuromedin B has been shown to have anti-inflammatory effects on infectious diseases such as meningitis, sepsis, and tuberculosis, which may be due to its ability to inhibit neutrophil migration. Neuromedin B also stimulates hippocampal formation activity in rats during the rotarod test, which may be due to its effects on dopamine release.</p>

<p>Please enquire for more information about Galanin-Like Peptide (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-2 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LHRH is a hormone that has been used to treat endometriosis, prostate cancer, and ovarian cysts. It is an agonist of the gonadotropin-releasing hormone receptor (GnRH receptor). LHRH binds to the GnRH receptor in the pituitary gland and stimulates the release of follicle-stimulating hormone and luteinizing hormone. This leads to increased production of estrogen and testosterone. LHRH has been shown to be effective in treating infectious diseases such as tuberculosis and HIV/AIDS. LHRH can also be used as a diagnostic aid for determining whether or not a tumor is cancerous by measuring its protein content.</p>

<p>2-Amino-3,5-dibromobenzonitrile is an electrophile that is used to synthesize various boronic acid derivatives. It also inhibits butyrylcholinesterase and 2-aminobenzonitrile, enhancing the activity of organophosphorus cholinesterase inhibitors. 2-Amino-3,5-dibromobenzonitrile has been shown to react with nucleophiles at the alpha position to form a stable intermediate. This reaction has been shown to be reversible in aqueous solution. The compound has been evaluated as a potential chemotherapeutic agent against cancer cells in vitro.</p>

<p>Please enquire for more information about Kisspeptin-13 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-(Ala7,Lys(Dnp)9)-Bradykinin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ([13C6]Leu10)-CRF (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Trt)-2-chlorotrityl resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>

<p>2-(2-Bromoethyl)-1,3-dioxolane is a synthetic chemical compound that is used for the asymmetric synthesis of fatty acids. It can be prepared by the cross-coupling reaction of ethyl formate with bromoethane and copper(II) acetate in trifluoroacetic acid. The reaction produces an unsymmetrical product with two aldehyde groups and two halides on each side of the molecule. It can also be prepared by the reaction of 2-bromoethanol with sodium formaldehyde sulfoxylate and sodium methoxide in methanol. This process produces a symmetrical molecule with one aldehyde group on each side of the molecule. 2-(2-Bromoethyl)-1,3-dioxolane has been shown to have anti-cancer properties in carcinoma cell lines.</p>

<p>Please enquire for more information about H-Asp-Pro-Gln-Phe-Tyr-OH hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gln(Trt)-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RANTES (3-68) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (3-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide W-30 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3-Benzylmorpholine Hydrochloride is a hydroxamate that is used as an acylating agent in organic synthesis. It is also used as a reagent for the preparation of hydroxamic acid and hydroxamic esters. 3-Benzylmorpholine Hydrochloride can be prepared by reacting 3-benzylmorpholine with hydrochloric acid or hydrogen chloride gas in the presence of a base such as triethylamine. The reaction starts by forming a hemiaminal, which reacts with the metal chloride to form the desired product. This reaction follows a kinetic, stereoelectronic, and rationalize mechanism. 3-Benzylmorpholine Hydrochloride has been shown to have chiral properties, which means it has two forms that are non-superimposable mirror images of each other. The enantiomeric purity can be determined using optical rotations or gas chromatography-mass spectrometry.</p>

<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Calcium-Like Peptide 3 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Piperazinoacetic acid anilide dihydrochloride is a high quality, reagent compound which can be used as a useful intermediate or a speciality chemical. Piperazinoacetic acid anilide dihydrochloride is a complex compound that has been shown to have a number of useful properties, such as being an effective building block for the synthesis of other compounds. It can also be used as a reaction component in the preparation of fine chemicals and research chemicals. This product is also versatile, allowing it to be built into different scaffolds to create new compounds.</p>

<p>Please enquire for more information about APL1b28 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>3,3'-Dichlorodiphenylacetylene is a versatile building block that is used in the synthesis of complex compounds. It has been used as a reagent and as a speciality chemical for research purposes. This chemical can be used as a useful building block for the synthesis of other compounds, or it can be reacted with other compounds to form new compounds. 3,3'-Dichlorodiphenylacetylene is also an intermediate in organic syntheses and has been shown to react with many different types of molecules.</p>

<p>2-Methoxypropyl)amine hydrochloride (2MPPA) is a versatile building block that can be used in the synthesis of complex compounds. It is a research chemical that is used as a reagent and as a speciality chemical for the production of pharmaceuticals, agrochemicals, and other organic chemicals. 2MPPA can be used as an intermediate in the manufacture of useful scaffolds or useful reaction components. This product has CAS number 70807-90-8 and is of high quality.</p>

<p>2-(Difluoromethoxy)Phenol is a purine derivative and pyrimidine derivative. It has been shown to inhibit the growth of cancer cells in vitro and in vivo. 2-(Difluoromethoxy)phenol inhibits multidrug resistance by inhibiting the transport of drugs into cells and thereby preventing their accumulation. As a result, it suppresses inflammatory diseases and autoimmune diseases. The hydroxyl group in this compound can be replaced with fluorine or nitro groups to generate new derivatives with different properties. Piperidine can also be added to this molecule to create an analogue that is more potent than 2-(difluoromethoxy)phenol and has a longer duration of action.</p>

<p>Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.</p>

<p>Please enquire for more information about Suc-Ala-Ala-Pro-Abu-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prepro-Neuromedin S (70-103) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>